Identifiers and Description

Gene Model Identifier

TTHERM_00599940

Standard Name

CHS1 (CHitin Synthase)

Aliases

PreTt22060 | 83.m00129 | 3685.m00021

Description

Chitin synthase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01644 ) Chitin synthase
  • ( PF03142 ) Chitin synthase
  • ( PF08656 ) DASH complex subunit Dad3
  • ( PF00902 ) Sec-independent protein translocase protein (TatC)
  • ( PF00594 ) Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00599940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14868.19.997093137033517e-262chitin synthase (884 aa)
SGDYNL192W6.001502944943701e-53CHS1 Chitin synthase I, requir
es activation from zymogenic f
orm in order to catalyze the t
ransfer of N-acetylglucosamine
(GlcNAc) to chitin; required
for repairing the chitin septu
m during cytokinesis; transcri
ption activated by mating fact
or
OxytrichaContig20733.0.g181.9998745702418095e-48Chitin synthase
Stentor CoeruleusSteCoe_242382.9374821117108028e-30
WormBaseWBGene000004970.0000000000002999981760818895locus:chs-2 status:Confirmed
UniProt:G5EBQ8 protein_id
:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00599940(coding)
ATGAGTTCAAGACTTTTCAGTTTAAAAACAAATCTCGCTTAACCTAAGGTAGAGTATAAG
CACTAAATTTTGGCTCCTGTTGAGTTAAAAATGGAAAAAGAAATACCTTAACCTGGAAGC
CATATTAATAAATTTATCCTCAAAGGATGCAGTAGGACTTCAAAAGACCCATATCTGTCA
TAAAAATTTGAATAAATAAAGGATATAGTAGATGATCAAAAAGTTCCTAACCATGGTTTA
ATCTCTCTTTATAATTAAAAATCTACCAATGATGAATCTCTCAAGATTAAGCCCAAGTTA
GCCATTTGTATTACAATGTATAACGAAGCAAGAAAAGAATTAGAATCAAGTTTGGATGGT
ATTTTGAGAAACATGAAGCATTTCAAAAAAAATTTAGGAATTTAAAACGAAGAAATAGTT
GTCGTTGTAATTTATGACGGTATTGACAAAATAAATAATGAAAAAGATCCAGATGACAAT
ATGATTGAATACTTCAAATTATGGGATCGTGTTGAAGGTTCTAAATACCACAACTCTAAC
TTTACTATTCCTAGAAAATATGAAAAATTCAAAGAGTAGTTGGAGCGTTCTAAGTATCAA
GTAGAATAACTCAGAAATGATGACTTTAAGATCTTCAAGCAAAATGAGAAGCTTAACGAA
GAATATATAAAATATAAATCAACTATAACTGATGATGTCAGACAAGAAGATGCTAAAAAG
GCTGATTTCTTGTATTCTGTGAAATAAAAAGCTTAAAAATATATTGACTCAAAGAGCAAT
AACGCTATACTTTATCAAATGAGAGAACGTATTTCAAAAGTTGTTGATTAGAACTAGGAA
CAAGAAAAATCATCAAGCGCTAATGATGAAACTGAGGATTATCTCCATATTTTCCATTGC
ATCAAGTATAAAAATGGTGGTAAACTTTCAAGTCATTTGTGGTTCTTTTGTGGTTTTTGT
GAGTTATTCTAGCCTGAGCATACTATTTTGTTAGATTGTGGTCTCATTCCAGATGAAACT
GCACTAGTCAATATGTATTTAGCCTTAGAAACAGACAAAGATATTGGAGGAGTCTGTGGT
TTTATGGGTATTAAATTATAGAATGTCTATAATGAATCAGGAGAGAGAACTGATAACTTT
GATGAAAAACAAGTAGACTGGATTTCATAATTGTATGAAGAAACATTTAGCATTCAAAAG
GCTTAGATGTTTGAGTATAACATGGGTCATTTAATTGATAAACCTTTTGAATCTTTATTT
GGGTTTATTTAAGTTCTTCCTGGTGCTTTTAGTGGTTACCGCTGGGAAGCTTTGAAAAGA
GATAATGATGGAAATTCTATTTTAGATGATTACTTAGCAAGTGTCTTAGATAAAGAGTAG
GAACTAACTTTAGAATAATAAAATATGAATCTAGCTGAAGATAGAATTCTTTGCTTAAAA
ATATTCTCTAAAAAAGGAAAAAAGTATACCTTAAGATATATTAGAAATGCTACTGCTAGA
GTCGATCCTGTCACAGATTTGGTCACCTTAGTTGGTCAAAGAAGAAGATGGATTAATGGA
TCATATTTTGCACTTATAGAAGCGCTTAAGAAGAAGAGTATTGTATACGAATCAGACCAT
ACAACTTGGGAGCTTTTAAAGTTTAAGATTTGTATGAAATTCGCTCAATTAAATAATTTT
TTGGGATATGTCTCTTTATCAGTATTCTTTACTATAGTGTTCATCATGATTTTAACTAAC
GTTGAAACAATTACTCTTAATTAAGCTTAGGATACAAACTCAATAGTTTCAGTTGTATTG
ACCACTCTTTTCTTAGTCTCTTACTTTATGTGCATTTTAATGATCATTTATTACTCAATA
GCTTTCAATAATAGAAATCCTAAAGTTATATCTTCATTTTACGCTATTTCTACTTATTTA
GGTATAATTATGTTAGCAGCCTTTGGTCTTATGATGGCATACGTTGTCGAAATGTTCATC
TATGTAATTAAAAAGAACATAATTGGAAATATTTCAATAGAAGAAGAAAATAGAGGTTTG
TTAAGCTCATGGAAAGATGAAAAATTACGTACTGTCTTCTCCTGGATAGTCGTTTTAGGT
TTTGCAATTAATGTTATTCCTATCCTTTGGTACCCCACTAAAATTATTGAGATTCTTAAG
TCTTTCATTCACTATATGGCTTATTAAGCATAATATATTCATTTATTGCTTATATACGCT
ATTTGTAGAATTGATGATCTCTCTTGGGGAACTAAAAACTCTGATGACAGTGGTGCCTAA
CAAGAATTGAGCAAGCAAATTAAGTTTAAATTCGTAGCTGAGTGGTTCATAACTAACGTC
ACTATTGGTATAGTTTTCTCTATCCTATTAACAAGTAAAGTTATTGAAGAAGATGAGTAA
TTCTCTAGAATAAAACCTTACATTTTATTCATAATTTCTATTTTCCTAACTGGACAGCTT
TTATTCAGAATTTTCTTTGCCACCATCCATGAAATCTACTTTATATTCTTCAGAATATAA
ATGAATGAAAAATCAAAAAAAATCAAAAGAGATTAAGATAGCTAAAGCAAATTAAGAGAA
ATCAGAAATAAATTATTTAACAACTAATGA


>TTHERM_00599940(protein)
MSSRLFSLKTNLAQPKVEYKHQILAPVELKMEKEIPQPGSHINKFILKGCSRTSKDPYLS
QKFEQIKDIVDDQKVPNHGLISLYNQKSTNDESLKIKPKLAICITMYNEARKELESSLDG
ILRNMKHFKKNLGIQNEEIVVVVIYDGIDKINNEKDPDDNMIEYFKLWDRVEGSKYHNSN
FTIPRKYEKFKEQLERSKYQVEQLRNDDFKIFKQNEKLNEEYIKYKSTITDDVRQEDAKK
ADFLYSVKQKAQKYIDSKSNNAILYQMRERISKVVDQNQEQEKSSSANDETEDYLHIFHC
IKYKNGGKLSSHLWFFCGFCELFQPEHTILLDCGLIPDETALVNMYLALETDKDIGGVCG
FMGIKLQNVYNESGERTDNFDEKQVDWISQLYEETFSIQKAQMFEYNMGHLIDKPFESLF
GFIQVLPGAFSGYRWEALKRDNDGNSILDDYLASVLDKEQELTLEQQNMNLAEDRILCLK
IFSKKGKKYTLRYIRNATARVDPVTDLVTLVGQRRRWINGSYFALIEALKKKSIVYESDH
TTWELLKFKICMKFAQLNNFLGYVSLSVFFTIVFIMILTNVETITLNQAQDTNSIVSVVL
TTLFLVSYFMCILMIIYYSIAFNNRNPKVISSFYAISTYLGIIMLAAFGLMMAYVVEMFI
YVIKKNIIGNISIEEENRGLLSSWKDEKLRTVFSWIVVLGFAINVIPILWYPTKIIEILK
SFIHYMAYQAQYIHLLLIYAICRIDDLSWGTKNSDDSGAQQELSKQIKFKFVAEWFITNV
TIGIVFSILLTSKVIEEDEQFSRIKPYILFIISIFLTGQLLFRIFFATIHEIYFIFFRIQ
MNEKSKKIKRDQDSQSKLREIRNKLFNNQ


>TTHERM_00599940(gene)
ATGAGTTCAAGACTTTTCAGTTTAAAAACAAATCTCGCTTAACCTAAGGTAGAGTATAAG
CACTAAATTTTGGCTCCTGTTGAGTTAAAAATGGAAAAAGGTATGCATTAATTAAGAAAA
TTAACTTTTAGAAAGCAACATACAATTAAATATAAATAGAAATACCTTAACCTGGAAGCC
ATATTAATAAATTTATCCTCAAAGGATGCAGTAGGACTTCAAAAGACCCATATCTGTCAT
AAAAATTTGAATAAATAAAGGATATAGTAGATGATCAAAAAGTTCCTAACCATGGTTTAA
TCTCTCTTTATAATTAAAAATCTACCAATGATGAATCTCTCAAGATTAAGCCCAAGTTAG
CCATTTGTATTACAATGTATAACGAAGCAAGAAAAGAATTAGGTATATTTTTATCTACTA
ATTTACTTATAAATTAATAAAATCATTATTAAAGAATCAAGTTTGGATGGTATTTTGAGA
AACATGAAGCATTTCAAAAAAAATTTAGGAATTTAAAACGAAGAAATAGTTGTCGTTGTA
ATTTATGACGGTATTGACAAAATAAATAATGAAAAAGATCCAGATGACAATATGATTGAA
TACTTCAAGTAATTTAAAAATAACATAACACAAATTAAACAAAAATATTTAAAAATAGAT
TATGGGATCGTGTTGAAGGTTCTAAATACCACAACTCTAACTTTACTATTCCTAGAAAAT
ATGAAAAATTCAAAGAGTAGTTGGAGCGTTCTAAGTATCAAGTAGAATAACTCAGAAATG
ATGACTTTAAGATCTTCAAGCAAAATGAGAAGCTTAACGAAGAATATATAAAATATAAAT
CAACTATAACTGATGATGTCAGACAAGAAGATGCTAAAAAGGCTGATTTCTTGTATTCTG
TGAAATAAAAAGCTTAAAAATATATTGACTCAAAGAGCAATAACGCTATGTAATTTATAG
ACTTTATGATTAGATTTTATAAAATTTGACATCATTTAAATAATTAAATAATATAACCAA
ACGAAATTAATTTTTTTAAATTTATAGACTTTATCAAATGAGAGAACGTATTTCAAAAGT
TGTTGATTAGAACTAGGAACAAGAAAAATCATCAAGCGCTAATGATGAAACTGAGGATTA
TCTCCATATTTTCCATTGCATCAAGTATAAAAATGGTGGTAAACTTTCAAGTCATTTGTG
GTTCTTTTGTGGTTTTTGTGAGTTATTCTAGCCTGAGCATACTATTTTGTTAGATTGTGG
TCTCATTCCAGATGAAACTGCACTAGTCAATATGTATTTAGCCTTAGAAACAGACAAAGA
TATTGGAGGAGTCTGTGGTTTTATGGGTATTAAATTATAGAATGTCTATAATGAATCAGG
AGAGAGAAGTAATTAATTAAATTCATTTAAATAATTTACAATGGTTAATTTAAATAAATA
CATTAATAAATAAATAAATAACAGCTGATAACTTTGATGAAAAACAAGTAGACTGGATTT
CATAATTGTATGAAGAAACATTTAGCATTCAAAAGGCTTAGATGTTTGAGTATAACATGG
GTAAATAATTAATTAATAAATAATTTTCCTCTTCATTTATTTTTGCTAACTATTTTAATT
AATTTAATTAGGTCATTTAATTGATAAACCTTTTGAATCTTTATTTGGGTTTATTTAAGT
TCTTCCTGGTGCTTTTAGTGGTTACCGCTGGGAAGCTTTGAAAAGAGATAATGATGGAAA
TTCTATTTTAGATGATTACTTAGCAAGTGTCTTAGATAAAGAGTAGGAACTAACTTTAGA
ATAATAAAATATGAATCTAGCTGAAGATAGAATTCTTTGCTTAAAAATATTCTCTAAAAA
AGGAAAAAAGTATACCTTAAGATATATTAGAAATGCTACTGCTAGAGTCGATCCTGTCAC
AGATTTGGTCACCTTAGTTGGTCAAAGAAGTAATTAACTAAATTATTTTCTTCGATTTTA
ATTTTATTAATTGATAAATTTCTTAAAATAATTTTCAGGAAGATGGATTAATGGATCATA
TTTTGCACTTATAGAAGCGCTTAAGAAGAAGAGTATTGTATACGAATCAGACCATACAAC
TTGGGAGCTTTTAAAGTTTAAGATTTGTATGAAATTCGCTCAATTAAATAATGTAAGTTT
AGAATTTAAATAAAAAATTAATTTACTAATCTCTTATTGAATATTTTCTAGTTTTTGGGA
TATGTCTCTTTATCAGTATTCTTTACTATAGTGTTCATCATGATTTTAACTAACGTTGAA
ACAATTACTCTTAATTAAGCTTAGGATACAAACTCAATAGTTTCAGTTGTATTGACCACT
CTTTTCTTAGTCTCTTACTTTATGTGCATTTTAATGATCATTTATTACTCAATAGCTTTC
AATAATAGAAATCCTAAAGTTATATCTTCATTTTACGCTATTTCTACTTATTTAGGTATA
ATTATGTTAGCAGCCTTTGGTCTTATGATGGCATACGTTGTCGAAATGTTCATCTATGTA
ATTAAAAAGAACATAATTGGAAATATTTCAATAGAAGAAGAAAATAGAGGTTTGTTAAGC
TCATGGAAAGATGAAAAATTACGTACTGTCTTCTCCTGGATAGTCGTTTTAGGTTTTGCA
ATTAATGTTATTCCTATCCTTTGGTACCCCACTAAAATTATTGAGATTCTTAAGTCTTTC
ATTCACTATATGGCTTATTAAGCATAATATATTCATTTATTGCTTATATACGCTATTTGT
AGAATTGATGATCTCTCTTGGGGAACTAAAAACTCTGATGACAGTGGTGCCTAACAAGAA
TTGAGCAAGCAAATTAAGTTTAAATTCGTAGCTGAGTGGTTCATAACTAACGTCACTATT
GGTATAGTTTTCTCTATCCTATTAACAAGTAAAGTTATTGAAGAAGATGAGTAATTCTCT
AGAATAAAACCTTACATTTTATTCATAATTTCTATTTTCCTAACTGGACAGCTTTTATTC
AGAATTTTCTTTGCCACCATCCATGAAATCTACTTTATATTCTTCAGAATATAAATGAAT
GAAAAATCAAAAAAAATCAAAAGAGATTAAGATAGCTAAAGCAAATTAAGAGAAATCAGA
AATAAATTATTTAACAACTAATGA