Identifiers and Description

Gene Model Identifier

TTHERM_01433580

Standard Name

CHN4 (CHitiNase)

Aliases

PreTt21720 | 386.m00009

Description

Chitinase class I family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01433580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20131.19.997093137033517e-262chitinase class I family prote
in (398 aa)
WormBaseWBGene000202700.0000020007268868677913status:Partially_confirmed U
niProt:O16512 protein_id:CCD
72033.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01433580(coding)
ATGAGATACTCTAAATTAAGTGCGCTTGCTCTAGTCCTCTTGATTAGTTGCTAAGTCTTT
GCTACTGATTATAGAAACCTTCAATCATAAGGCGATTGTAAATGCACTTGCGATTGCAAA
GTACCAGACAACAACAATAATAATAACAACAACAATAACAACAATAATAATAACAACAAC
AATAATAATAACAACAACAACAATAACAATAATAACAACAATAACAATAACAACGGAGGA
AATAGCACTAAACAACCAAGAAACTTTACTGCTTGGTTTGCTAATTCTAAGCCAGACGCT
TGGGGTAATACAGGTCTTCCCGTTATTTTGAAAAATATTAATGGTGTTATTACTAAAGCT
TAATCTGATAAATGGTTAGCAGATATAACTAATGCAGCAAAAGCTTTCCCTGATTTTTGT
AACAGTGGTAATGAATAAAAAGATAAGCAAGAGTTTGCTGCCTTCTTAACAATTATTGGT
GCTGAAACATCATTTGATCCTTCAAATGGATTCCCTTGCACAAAGGAAAATGGATGTCCT
AATTGTGATGCTTGTTCTTACAATTCTAAAGGAAAGTAATGCAGCACAACTCCTAATCTA
TAGTATTATGGAAGAGGTCCTTTATAATTATCTTGGGATTACAATTACATTAATTTCTCA
CAATATTACTTCAAAGATAACAGAGCTCTTACCAATCCTGACATTGTTACTTAGGACTAA
TAGACTTGCTGGGCTAGTGCAATCTGGTTTTGGATGACTCCCTAAAATTATGGTGGTTGG
TGTATGCCATAAGCAGCATGGCCAAGCAGAGATGCCTGTGCTTAAAGCTGTCCTAATGGT
CCTTCTGGCTGTTCTAACAGTGCTTGTACATCCAATCATTGGCTTAATACTGGAAAAGCA
AGTCCCCATGATGCTATATAAACCGGAAAAGGTATTGGTTAAGTAATCAATATTATTAAT
GGTGGTTACGATTGTTGCCCTTCAACAACTTATAAGACCTAGTATGGTCACACTGTGCAC
AGAATTGAATGGTTTGCTGAAATACTTTAGCTGTGGGGAGAGCCTTTACCTTACTCAAAC
TTATCAACTGTTCCTATAGAAGAATGTCCTGCAGCTCAAGGATCAATAGATTGTAGCAGA
TTAGCTGGTACTTGCTATTGGAACTGCTGTTCTGCTAAATCATGA


>TTHERM_01433580(protein)
MRYSKLSALALVLLISCQVFATDYRNLQSQGDCKCTCDCKVPDNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNGGNSTKQPRNFTAWFANSKPDAWGNTGLPVILKNINGVITKA
QSDKWLADITNAAKAFPDFCNSGNEQKDKQEFAAFLTIIGAETSFDPSNGFPCTKENGCP
NCDACSYNSKGKQCSTTPNLQYYGRGPLQLSWDYNYINFSQYYFKDNRALTNPDIVTQDQ
QTCWASAIWFWMTPQNYGGWCMPQAAWPSRDACAQSCPNGPSGCSNSACTSNHWLNTGKA
SPHDAIQTGKGIGQVINIINGGYDCCPSTTYKTQYGHTVHRIEWFAEILQLWGEPLPYSN
LSTVPIEECPAAQGSIDCSRLAGTCYWNCCSAKS


>TTHERM_01433580(gene)
AAAAAATTAAATTTCTAACTAAAAAACTCAATGAGATACTCTAAATTAAGTGCGCTTGCT
CTAGTCCTCTTGATTAGTTGCTAAGTCTTTGCTACTGATTATAGAAACCTTCAATCATAA
GGCGATTGTAAATGCACTTGCGATTGCAAAGTACCAGACAACAACAATAATAATAACAAC
AACAATAACAACAATAATAATAACAACAACAATAATAATAACAACAACAACAATAACAAT
AATAACAACAATAACAATAACAACGGAGGAAATAGCACTAAACAACCAAGAAACTTTACT
GCTTGGTTTGCTAATTCTAAGCCAGACGCTTGGGGTAATACAGGTCTTCCCGTTATTTTG
AAAAATATTAATGGTGTTATTACTAAAGCTTAATCTGATAAATGGTTAGCAGATATAACT
AATGCAGCAAAAGCTTTCCCTGATTTTTGTAACAGTGGTAATGAATAAAAAGATAAGCAA
GAGTTTGCTGCCTTCTTAACAATTATTGGTGCTGAAACATCATTTGATCCTTCAAATGGA
TTCCCTTGCACAAAGGAAAATGGATGTCCTAATTGTGATGCTTGTTCTTACAATTCTAAA
GGAAAGTAATGCAGCACAACTCCTAATCTATAGTATTATGGAAGAGGTCCTTTATAATTA
TCTTGGGATTACAATTACATTAATTTCTCACAATATTACTTCAAAGATAACAGAGCTCTT
ACCAATCCTGACATTGTTACTTAGGACTAATAGACTTGCTGGGCTAGTGCAATCTGGTTT
TGGATGACTCCCTAAAATTATGGTGGTTGGTGTATGCCATAAGCAGCATGGCCAAGCAGA
GATGCCTGTGCTTAAAGCTGTCCTAATGGTCCTTCTGGCTGTTCTAACAGTGCTTGTACA
TCCAATCATTGGCTTAATACTGGAAAAGCAAGTCCCCATGATGCTATATAAACCGGAAAA
GGTATTGGTTAAGTAATCAATATTATTAATGGTGGTTACGATTGTTGCCCTTCAACAACT
TATAAGACCTAGTATGGTCACACTGTGCACAGAATTGAATGGTTTGCTGAAATACTTTAG
CTGTGGGGAGAGCCTTTACCTTACTCAAACTTATCAACTGTTCCTATAGAAGAATGTCCT
GCAGCTCAAGGATCAATAGATTGTAGCAGATTAGCTGGTACTTGCTATTGGAACTGCTGT
TCTGCTAAATCATGA