Identifiers and Description

Gene Model Identifier

TTHERM_00527400

Standard Name

CHN3 (CHitiNase 3)

Aliases

PreTt06472 | 66.m00271 | 3722.m00128

Description

Chitinase class I family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 49.3%

TetraMine Data

TTHERM_00527400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_169200
Tetrahymena borealisEI9_13464.19.997093137033517e-262chitinase class I family prote
in (338 aa)
WormBaseWBGene000202700.00000008001913847069386status:Partially_confirmed U
niProt:O16512 protein_id:CCD
72033.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00527400(coding)
ATGAAAACTCATTAAATTTATCTTATTTTCATTTCACTAATCCTACTTTTGTTAGGTTCT
TATATTATAATTTCATCAAATCATCCAAATAAGACTTCAAGAGATTTTAAGGCATGGCTT
TCTACAATTCCTCCTAATCCTTGGGGAGACACAAGTTTAAGAGCATTAATTAGAAATCTT
AATGGTGTTGTTACTGTTTAATAGCAAGATTCTTGGCTTGAGAGCATTACTGAAGCAGCA
AAATCTTTCCCAGATTTTTGCAATAGTGGAGATGAAGCTAAAGATAAATAAGAATTCTCA
GCATTCTTAACAATTATTGGTTATGAAACTTCATTTAACTCTGCTAATGGTTTTCCATGC
ACAATTGAAAATGGTTGTCCTAATTGTGATGTTTGTTCTTATAATTCACTCGGAAAAGAG
TGTTTAGAAGATGACCTTAAGTAATACTTTGGCAGAGGTCCTTTGCAGCTTTCTTGGAAT
TATAACTATGGACCATTCTCACAATATTACTTTCAAGATGATAGATTGTTAAGTAATCCA
AATATCTTGACAACAAATTAAACCTATTGCTGGGCTAGTGCTATTTGGTTTTGGATGACA
AAATAAAATTATGGAGGTTGGTGTATGCCTTAAGTTGCATGGCCAGGCAAAAATTAATGC
GATTTAGATTGCCCTAACGGACCCTCTAGTTGTAAGAATAGCTAATGTACTTCAAATCAT
TGGATGGAACTTTAAAACGCTAGTTGTCATGATGCTATTCATACAGGTAATGGAATAGGC
TAAGTAATTAATATTATTAATGGACTTTATGATTGTTGTCCCTCAAGTACTTACTTTGCT
TAAGGAGGACACACAATAGACAGAATATCATCTTTTGTTTAAATTCTTGAAAATTGGAAT
GAGCCTATTCCATTTAAGGTATTAAATCCTGCTCCTATCTATGATTGCCCTATAGCTCTT
AATCACGTAAACTGCTAAAATATTGAATAAACTGGGTCATGCAGAGCTATGTGA


>TTHERM_00527400(protein)
MKTHQIYLIFISLILLLLGSYIIISSNHPNKTSRDFKAWLSTIPPNPWGDTSLRALIRNL
NGVVTVQQQDSWLESITEAAKSFPDFCNSGDEAKDKQEFSAFLTIIGYETSFNSANGFPC
TIENGCPNCDVCSYNSLGKECLEDDLKQYFGRGPLQLSWNYNYGPFSQYYFQDDRLLSNP
NILTTNQTYCWASAIWFWMTKQNYGGWCMPQVAWPGKNQCDLDCPNGPSSCKNSQCTSNH
WMELQNASCHDAIHTGNGIGQVINIINGLYDCCPSSTYFAQGGHTIDRISSFVQILENWN
EPIPFKVLNPAPIYDCPIALNHVNCQNIEQTGSCRAM


>TTHERM_00527400(gene)
ATGAAAACTCATTAAATTTATCTTATTTTCATTTCACTAATCCTACTTTTGTTAGGTTCT
TATATTATAATTTCATCAAATCATCCAAATAAGACTTCAAGAGATTTTAAGGCATGGCTT
TCTACAATTCCTCCTAATCCTTGGGGAGACACAAGTTTAAGAGCATTAATTAGAAATCTT
AATGGTGTTGTTACTGTTTAATAGCAAGATTCTTGGCTTGAGAGCATTACTGAAGCAGCA
AAATCTTTCCCAGATTTTTGCAATAGTGGAGATGAAGCTAAAGATAAATAAGAATTCTCA
GCATTCTTAACAATTATTGGTTATGAAACTTCATTTAACTCTGCTAATGGTTTTCCATGC
ACAATTGAAAATGGTTGTCCTAATTGTGATGTTTGTTCTTATAATTCACTCGGAAAAGAG
TGTTTAGAAGATGACCTTAAGTAATACTTTGGCAGAGGTCCTTTGCAGCTTTCTTGGAAT
TATAACTATGGACCATTCTCACAATATTACTTTCAAGATGATAGATTGTTAAGTAATCCA
AATATCTTGACAACAAATTAAACCTATTGCTGGGCTAGTGCTATTTGGTTTTGGATGACA
AAATAAAATTATGGAGGTTGGTGTATGCCTTAAGTTGCATGGCCAGGCAAAAATTAATGC
GATTTAGATTGCCCTAACGGACCCTCTAGTTGTAAGAATAGCTAATGTACTTCAAATCAT
TGGATGGAACTTTAAAACGCTAGTTGTCATGATGCTATTCATACAGGTAATGGAATAGGC
TAAGTAATTAATATTATTAATGGACTTTATGATTGTTGTCCCTCAAGTACTTACTTTGCT
TAAGGAGGACACACAATAGACAGAATATCATCTTTTGTTTAAATTCTTGAAAATTGGAAT
GAGCCTATTCCATTTAAGGTATTAAATCCTGCTCCTATCTATGATTGCCCTATAGCTCTT
AATCACGTAAACTGCTAAAATATTGAATAAACTGGGTCATGCAGAGCTATGTGA