Identifiers and Description

Gene Model Identifier

TTHERM_00683180

Standard Name

CHL1 (CHromosome Loss 1)

Aliases

PreTt16155 | 103.m00146 | 3734.m00058

Description

DNA repair helicase; involved in nuclear excision repair; localizes to the micronucleus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00683180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17807.29.997093137033517e-262DNA repair helicase (559 aa)
WormBaseWBGene000108394.9995060293141384e-98locus:chl-1 status:Partially
_confirmed UniProt:Q21489
protein_id:CAA88959.2
SGDYPL008W1.999022616705709e-90CHL1 Probable DNA helicase inv
olved in sister-chromatid cohe
sion and genome integrity; int
eracts with ECO1 and CTF18; mu
tants are defective in silenci
ng, rDNA recombination, aging
and the heat shock response; F
ANCJ-like helicase family memb
er
OxytrichaContig5554.0.g995.9988196117913e-83Helicase C-terminal domain
Stentor CoeruleusSteCoe_253182.7487850079102147e-43
DictyBaseDDB_G02866216.0018235484001396e-36fncJ on chromosome: 4 position
4729555 to 4732791

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000143

Sequences

>TTHERM_00683180(coding)
ATGAACAATAGAAGCACAAATAATGATTTAAAAGACAAAATTAAATAAAGCTTTCCTTAC
AATCCTTACGATATTTAATTAGAGTTTAGTTTGAACTTGTATGAGTCTTTGAATGTGAAG
AAGCTTTGTATATTTGAAAGTCCTACTGGTACAGGTAAGAGTTTGAGCTTAATTTGTGGC
GCGTTTAATTGGTTTAAAGATAACTAAGAAAACTACGATTTGATTAAAGGTTTCAAAGAA
AGGAGAGACAAAATTTTATTAGGAGAAGTCAATATAGATAGTAAAAAAGAAGAATCAAAT
AGCTTGCCTGCATGGCTAACGAATATAAATGATATTAATAGAAGTATTTTTTACGAAAAA
ATTTAAATATAAAAAAATAAATTAGCTTAAAAAGCAAAATCTCTTAAGGAATTTTAGATG
TTCAGAAAAGAAAAAATGAAAATAAGATATGAAGAGTACAAAAAAAATATTATCAAATAA
TAAAAGAACAATGAATAAGATAAAAAAGAGCATTAAGATGAAGATGAGTAATACTATGTG
AACTGGAAAGAAGAATAGGGAGGTGATGCAGAAATAGATATTGAATCCATGATCGAAGAT
TACAAGAAATCTAAAAGTCAAATTAGATAAAACAATGAATAAGATGAAAATGATAATGAA
AACACTACTATAAAAATAATTTATGCTAGTAGAACTCATAGTTAGATAAAATAATTTGTA
TAAGAAATATTGAAAACGAAATTTAAAGATATGAGAGTTATAACTTTAGGAAGTAGATAA
AATCTTTGCTTGAAATTTGATGAATAATCTAAACAATCTTTACAATAAATAGATGATTAT
TGCTAAAAAGCAATAGGAATTAATAAGACTGATAAGTCAGTTCCTCGTTGTGAGTACTTC
ACTAATTTAAAATTATTGCAAGATGATATTGATTATTTGTTTTTACATAATATTCACACT
TTGGATTAAATGAGATCTGAATCTCTCAACAATCAAGTGTGTCCTTACTATTTATCTAAA
AGAAGTGTTATTGATGCTGAAGTAATTTGCGTTCCTTATGTAACGTTGCTAGATGAAAAC
ATGAGAATAAATTCTAATATTGATATAACAAATTCTATCATTTTATTTGATGAATCACAC
AATATTCTAGAAAGTTTAAGTGGGATTAATTCTGTAGAAGTTACATATAAAAGAATTTTC
TAGGCATTTGTTTAGCTATTAACTTATTATGATAAGTTTTGCAGGAGACTTAACCCTAAG
AATGCCTTATTTATATAAAATATTAAAAACTTGTGTTTAGACCTGCTTAAATTCATCAAA
GCAGAAATAGATTTAAATGCTTCAATCAAATCTGAGCAAGATTATGTTAAAATTAACAAC
ATTTAGCTACTTCTCAAGCTCAATATGGACAGGATTGATTTCTTTTAAATTAAAAAATTT
ACTCAAGAGACTAGATTAGGTTAAAAAATACACTTTTTTTCTCAATCTCCTAAATATGTT
CCATCATAAATACCGCCTTAGGTTAACAAAAGTCTTAAAGACATAAATATTTAAGAATTA
TTAAAGAATAGCCCATATATGGTTGTAGAAAATGTTATGAATTTTCTTTGGAAAATGCAA
GATTCTATAAGCAAGAGTGAAAAGTATTCAATAATTATAAAAAATATTTCTAAAATTGAA
GAATCTTCTATTTAGCTGATGTGCTTAGATGTTATAGAACCTTTGTATAAAGTTATTCAG
GAAAGTGCTTGTGTAGTTTTAGCTGGAGGAACCATGGAACCTTTAAGTGAATTTGAATTA
CTAATCAATTAAGTTGGAAAGAATAACTTTAAACACTTCTCATGTGGTCACATAATTGAT
GAAGAAAATTGTTCTGTATTTTGTGTAAGCACTTTAGTTGAACAGTCTGATAAACCACTG
ATTTTCAATTACCAAAATAAAAAAGATGATTAATTATTTTAAAACTCAATAGATATTATT
CATTAATTAGCTCAAACAATTCCTGACGGTCTAGTTATTTTTGTATAAAGCTATACGTTT
CTAGAGAAACTAAAGAGCATCCTCTTAGAAAACTAAAATTTACTTTAATAAATCTAATAA
TATAAAAAAATATATATGGACGATAAAGATAATTCAAACAACACAATACTCGAAAAATAC
TAAAAAGAAATAAATAAAGAAAAAGAAATTGGAAGCAAAAAGAATGGCGCAATTTTAATC
TCTGTAATAGGTGGGAGACTAAGTGAAGGGATAAATTTTAGTGATTAACTTGCAAGGTGC
GTTGTAGTATTTGGAATGCCCTATTCAAATATTAAAAGTGCCGAATTAATAGAAAAAATG
AATCACTATGATTCCATATCAAAAAAAAATAACTTTAGCTTTAGTGGAAATGATTATTAT
GAAAATTTGTGTATGAAATCTGTGAACTAAGCAATTGGCAGGTCTATAAGACACAAAGAT
GATTATTCAGTTATACTCTTAATTGATTAGAGATTTTCTCAAGAAAAAAATATCAATAGA
TTATCAAGTTGGATTAAAAAAAGAGTAAAGCCAGCTCATTCTTTTGAAAGTACCAAAAAA
AATATTAAAATTTTTTTCGAAAAAAAACAACAACATAAGATTTGA


>TTHERM_00683180(protein)
MNNRSTNNDLKDKIKQSFPYNPYDIQLEFSLNLYESLNVKKLCIFESPTGTGKSLSLICG
AFNWFKDNQENYDLIKGFKERRDKILLGEVNIDSKKEESNSLPAWLTNINDINRSIFYEK
IQIQKNKLAQKAKSLKEFQMFRKEKMKIRYEEYKKNIIKQQKNNEQDKKEHQDEDEQYYV
NWKEEQGGDAEIDIESMIEDYKKSKSQIRQNNEQDENDNENTTIKIIYASRTHSQIKQFV
QEILKTKFKDMRVITLGSRQNLCLKFDEQSKQSLQQIDDYCQKAIGINKTDKSVPRCEYF
TNLKLLQDDIDYLFLHNIHTLDQMRSESLNNQVCPYYLSKRSVIDAEVICVPYVTLLDEN
MRINSNIDITNSIILFDESHNILESLSGINSVEVTYKRIFQAFVQLLTYYDKFCRRLNPK
NALFIQNIKNLCLDLLKFIKAEIDLNASIKSEQDYVKINNIQLLLKLNMDRIDFFQIKKF
TQETRLGQKIHFFSQSPKYVPSQIPPQVNKSLKDINIQELLKNSPYMVVENVMNFLWKMQ
DSISKSEKYSIIIKNISKIEESSIQLMCLDVIEPLYKVIQESACVVLAGGTMEPLSEFEL
LINQVGKNNFKHFSCGHIIDEENCSVFCVSTLVEQSDKPLIFNYQNKKDDQLFQNSIDII
HQLAQTIPDGLVIFVQSYTFLEKLKSILLENQNLLQQIQQYKKIYMDDKDNSNNTILEKY
QKEINKEKEIGSKKNGAILISVIGGRLSEGINFSDQLARCVVVFGMPYSNIKSAELIEKM
NHYDSISKKNNFSFSGNDYYENLCMKSVNQAIGRSIRHKDDYSVILLIDQRFSQEKNINR
LSSWIKKRVKPAHSFESTKKNIKIFFEKKQQHKI


>TTHERM_00683180(gene)
ATGAACAATAGAAGCACAAATAATGATTTAAAAGACAAAATTAAATAAAGCTTTCCTTAC
AATCCTTACGATATTTAATTAGAGTTTAGTTTGAACTTGTATGAGTCTTTGAATGTGAAG
AAGCTTTGTATATTTGAAAGTCCTACTGGTACAGGTAAGAGTTTGAGCTTAATTTGTGGC
GCGTTTAATTGGTTTAAAGATAACTAAGAAAACTACGATTTGATTAAAGGTTTCAAAGAA
AGGAGAGACAAAATTTTATTAGGAGAAGTCAATATAGATAGTAAAAAAGAAGAATCAAAT
AGCTTGCCTGCATGGCTAACGAATATAAATGATATTAATAGAAGTATTTTTTACGAAAAA
ATTTAAATATAAAAAAATAAATTAGCTTAAAAAGCAAAATCTCTTAAGGAATTTTAGATG
TTCAGAAAAGAAAAAATGAAGTGAATTAATTTTTTTAGAGAAAATATGTCTTAAAAAATA
TTTTTGTTTAATAAATTTTTAGAATAAGATATGAAGAGTACAAAAAAAATATTATCAAAT
AATAAAAGAACAATGAATAAGATAAAAAAGAGCATTAAGATGAAGATGAGTAATACTATG
TGAACTGGAAAGAAGAATAGGGAGGTGATGCAGAAATAGATATTGAATCCATGATCGAAG
ATTACAAGAAATCTAAAAGTCAAATTAGATAAAACAATGAATAAGATGAAAATGATAATG
AAAACACTACTATAAAAATAATTTATGCTAGTAGAACTCATAGTTAGATAAAATAATTTG
TATAAGAAATATTGAAAACGAAATTTAAAGATATGAGAGTTATAACTTTAGGAAGTAGAT
AAAATCTTTGCTTGAAATTTGATGAATAATCTAAACAATCTTTACAATAAATAGATGATT
ATTGCTAAAAAGCAATAGGAATTAATAAGACTGATAAGTCAGTTCCTCGTTGTGAGTACT
TCACTAATTTAAAATTATTGCAAGATGATATTGATTATTTGTTTTTACATAATATTCACA
CTTTGGATTAAATGAGATCTGAATCTCTCAACAATCAAGTAAAAAATATTAAACATAAAT
AAATAATTACTTTCATTATTTCAAAAAGTAAGTTGGAGATAAAACAAACTATCAATTTAT
TAATTATGTCTTTCTATTTTCTAATATCTAAAAATATCAAAATTATCAAGAAAAATGTTG
ATATAATTTAATAAAATTAGTGGATGAAATTATTAATAAGTTAACATATAAAAATAAATA
AAGGAAATTTTTATTTATAATAAATTAAAAAGGTGTGTCCTTACTATTTATCTAAAAGAA
GTGTTATTGATGCTGAAGTAATTTGCGTTCCTTATGTAACGTTGCTAGATGAAAACATGA
GAATAAATTCTAATATTGATATAACAAATTCTATCATTTTATTTGATGAATCACACAATA
TTCTAGAAAGTTTAAGTGGGATTAATTCTGTAGAAGTTACATATAAAAGAATTTTCTAGG
CATTTGTTTAGCTATTAACTTATTATGATAAGTTTTGCAGGAGACTTAACCCTAAGAATG
CCTTATTTATATAAAATATTAAAAACTTGTGTTTAGACCTGCTTAAATTCATCAAAGCAG
AAATAGATTTAAATGCTTCAATCAAATCTGAGCAAGATTATGTTAAAATTAACAACATTT
AGCTACTTCTCAAGCTCAATATGGACAGGATTGATTTCTTTTAAATTAAAAAATTTACTC
AAGAGACTAGATTAGGTTAAAAAATACACTTTTTTTCTCAATCTCCTAAATATGTTCCAT
CATAAATACCGCCTTAGGTTAACAAAAGTCTTAAAGACATAGTAATTAATTTCATTTAAT
ATAATTAAAACTATTTAATATTTTTTAAATTAAAATTAACTAGAATATTTAAGAATTATT
AAAGAATAGCCCATATATGGTTGTAGAAAATGTTATGAATTTTCTTTGGAAAATGCAAGA
TTCTATAAGCAAGAGTGAAAAGTATTCAATAATTATAAAAAATATTTCTAAAATTGAAGA
ATCTTCTATTTAGCTGATGTGCTTAGATGTTATAGAACCTTTGTATAAAGTTATTCAGGA
AAGTGCTTGTGTAGTTTTAGCTGGAGGAACCATGGAACCTTTAAGTGAATTTGAATTACT
AATCAATTAAGTTGGAAAGAATAACTTTAAACACTTCTCATGTGGTCACATAATTGATGA
AGAAAATTGTTCTGTATTTTGTGTAAGCACTTTAGTTGAACAGTCTGATAAACCACTGAT
TTTCAATTACCAAAATAAAAAAGATGATTAATTATTTTAAAACTCAATAGATATTATTCA
TTAATTAGCTCAAACAATTCCTGACGGTCTAGTTATTTTTGTATAAAGCTATACGTTTCT
AGAGAAACTAAAGAGCATCCTCTTAGAAAACTAAAATTTACTTTAATAAATCTAATAATA
TAAAAAAATATATATGGACGATAAAGATAATTCAAACAACACAATACTCGAAAAATACTA
AAAAGAAATAAATAAAGAAAAAGAAATTGGAAGCAAAAAGAATGGCGCAATTTTAATCTC
TGTAATAGGTGGGAGACTAAGTGAAGGTAACTTAATTTTAATTTAATTTAGAAAAAGATA
TTATAAAATTTACTTTATAGATCTAACTCTAATTTTTTTTAAAGGGATAAATTTTAGTGA
TTAACTTGCAAGGTGCGTTGTAGTATTTGGAATGCCCTATTCAAATATTAAAAGTGCCGA
ATTAATAGAAAAAATGAATCACTATGATTCCATATCAAAAAAAAATAACTTTAGCTTTAG
TGGAAATGATTATTATGAAAATTTGTGTATGAAATCTGTGAACTAAGCAATTGGCAGGTC
TATAAGACACAAAGATGATTATTCAGTTATACTCTTAATTGATTAGAGATTTTCTCAAGA
AAAAAATATCAATAGATTATCAAGTTGGATTAAAAAAAGAGTAAAGCCAGCTCATTCTTT
TGAAAGTACCAAAAAAAATATTAAAATTTTTTTCGAAAAAAAACAACAACATAAGATTTG
A