Identifiers and Description

Gene Model Identifier

TTHERM_00049310

Standard Name

CHD3 (Chromo-Helicase-DNA-binding domain 3 )

Aliases

PreTt11310 | 3.m01803 | 3824.m03069

Description

CHD3 SNF2 family amine-terminal protein; SNF2-related protein; SNF2 family N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00049310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01628.19.997093137033517e-262SNF2 family domain-containing
protein (1496 aa)
WormBaseWBGene000004821.9995317320402142e-140locus:chd-3 Chromodomain-hel
icase-DNA-binding protein 3 ho
molog status:Confirmed Uni
Prot:Q22516 protein_id:CAA91
810.1
DictyBaseDDB_G02841717.0010636619989215e-130chdA on chromosome: 4 position
1645755 to 1651739
OxytrichaContig16139.0.g366.001241942754875e-123SNF2 family N-terminal domain
SGDYOR304W9.99679536751975e-103ISW2 ATP-dependent DNA translo
case involved in chromatin rem
odeling; ATPase component that
, with Itc1p, forms a complex
required for repression of a-s
pecific genes, INO1, and early
meiotic genes during mitotic
growth
Stentor CoeruleusSteCoe_297142.2856936767186716e-49

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00049310(coding)
ATGTAGCGGTATATCAGCATTTTTTATTAAATAAATAATACTAAAGAAGAAGAAAATATA
AACTATAAAAAACAACCGCGAAAGTCCAAATTTACAAATAAAAAAAGAAAGAAAATATAA
ATCAAAGTAATTATCTTAATCATAATAAAAATTAAGCATTTTAAAAGAAATAAAGAAATA
ACTGATAAGCATAATATCAATTTCTTAAGTACAAAAGATATATTAATTATTAAATTTAAG
ATGGGTACTCGTAGAAGATAGTAAGCAGTCTCCAATGATGAAAGCAGTAGTAAATAATAG
GAAGTGACTTAGAGAACGCTTAGAACAAGGACAAAAAAACTCAAAGTTGTTTCAGATTCA
GAGGATGATTTAGAAGACGAATTAGACGCATAGTATGATGATGAAGAGGAAGATTTTGAT
GATGAGGCAGTGCGTAAGCCAAAATCTAAAAAGAATTTAAAGAAAAATAGTAGCATCATA
AAATCTGGTAATGGAAGAGGCAGAAAGAGTAAAGCCAAATAAAAGAAGAATGAGGATTCC
ATGCAAGAAGAAGAAGAAGAATCTATTTAAGGAGGAGAAGAGGACAATAACTAAGCTGAA
AATGAAATTGAAGAAGAAATAGAGGGTAACGAATAAGACGATTAAGCTCATGATTAAGGA
GAATATGCAGAGGATGATCTCGAAGATGAGCCCCCTTCAGACGATTATGAATATGACTCC
GAAGAAAAAGCTAATAAGGTATAACGTGACGAAGTGTACAATCTTTCAGAAACAGATGCA
AATGAGAGTTGGTGCTTTATTTGTAGAGATTAGGGAAAACTTATATGCTGTGAAAATTGC
TCAAAAACATTCCACTTGACTTGTGTGGGTATTAAAAAGCCTCCAACTGGTGCTTGGGAA
TGTCCTTACTGCAGAGAAGAAAATAAAGATATATGCTGTGCATGTGAAAAGAGTACTAAT
GAAGCTGAAATTAAAGTTACTTGTTCCCTTTGCTATCGTTTAATGCATTTTGAATGTTTA
GGTATTCCTCTTAAATAGCTCGTAGATTGTCCAATGAATAGAAATTATTTTTTGGATGCA
GATACTCTTACTATATTGCAATCAATTAGTGACAAAGATGATGCAGAAGTAGCTAATGAG
AAGTTAAAAAATTTGACTGAAGCCATTAAAAAGCTTCATACTACTGAAGGAAAATAAATT
TTATATTCTTGCTTTACTTGCATAGGCTATTTTGGAATAGATAAAATTTAAGATTATGTC
TCAACTGAAGTTGGCAACTGCTTTATCACAAAATTAAATAATGCTGCTTATATCCACAGT
TATTGGTTACCTGAGTCTGTAGTTGAAAGGAAAATCCCAAGAAAACTTAAAAATTTCAAA
GATAAGAAAAAATAAGTTAAAGTTGCAATTGATGAAGAAGAAATAGAAATAGCATTAACT
GAAGAGCCTGTTGATGTTTTAGAAGAAAATATAAAAATAGAAAGAATTATTGACTGCAAA
CGTCCTATAAAGCATGCCAAGCGTTCATACAGAGATATTTATGATTCTATATTCAGCAAA
TATGGAGATTTATATGAAAAATAAATTGTCTTTGGAGCAAAAACAAATTATAAATTCCTT
ATCAAGTGGTAGGGACTCTTCTATGATGAATGTACTTTCGAAGATGAGTTCATAGTTCTT
AAATACAAAGAAATTTTAAGAAAATATTTGTAAATAAAGATGTTTGAGGAAACTATTGGA
ACTCCAAGATTTTAAGAAGAAAGAGAAAACAAAAGAAAAATAAACACTCAAGTATAAAAG
AAGTATAAGCAATAACCTAATTTTATCACAGGTGGTTCATTACACAAGTTTTAAATAGAT
GGTGTTAATTGGCTTTCAGAAAGTTATAACAAAGCAAACAATGTTATTCTTGCAGATGAA
ATGGGTCTTGGTAAAACTGTGTAGACTGTTTCTTTCTTAAATTATTTGTACTATGAGAAA
GATATTGATGGACCTTTCATGGTAGTTGCTCCTGCCTCCACATTGTATAATTGGCTGAGG
GAATTTGCCATTTGGGGAGATAAATTCAATGTACTTGTGTATACTGGAAACTAAGCTTCT
CGTAGCTTGGTCAGACATCGTGAGTTTTATTTCAAAATCAAAAATCCCCTTAAGAAGGGC
AAGAAGAAAAAAGATTTAGTACCTAAATTTAATGCATTGATTACAAGTTATGATACAGCT
ATCAATGATGCTCATTTCTTAAGAAAAATTCAATGGGAATGCTTGGTTGTTGATGAAGCC
CACAGACTTAAAAATAACGAATCTAAATTCTTTAAAATCTCATCAACTATCGCAACAAGA
CATAAAGTTCTATTGACAGGTACTCCCTTACAAAATAATATATTGGAATTACTCAATTTA
ATCGAATTTATCTGTCCTTAGAAGGCTAAAACAATGAAAAATTTCGAAAGCTTAAAAATG
TTTTTATAAACAACAACTACATAAACTAAATAGCAATAGCAATAGGATGAGTAAATACCT
GAGGCTGAACGAAAGAAGGCCTTAAGTGAGTTAACTAAAATGCTTGCTCCTCACTTGTTG
CGTCGTAAAAAAACAGATGTCGATTTAGAATTGCCTGAAATGGAAGAAATTATTATTAAG
ATCTCTTTAACTGATACCCAAAAGTATTACTATAAAAATGTATTAGTCAAGAACTATGAT
AACTTGAAATTACTTGACGCTAAATCTAAAAACTTCTCTAAATTTTCTTTACTTAACATT
CTTATGAGTTTACGTCTTGTTTGTAATCATCCTTCCCTTTTCTTATACAAAAAGAAATAT
CTCATTCCTAAAAAAGACAAATTCTAAGAAGAATTTGTTGATTGTTCAAATAAACTTAAG
TTTTTAGAACGTATGATTCCTAAACTTTTGTAATAAAATCACAAAATGCTTATTTTCTCA
TAATTCACAATGATGCTTGATATTATGGGAGAATTCTTTAACTTCAAAGGATGGGCTTTT
GAAAGACTTGATGGTACAACCTCTGTCATCGACCGTTAAAAAACTATTGACTCTTTTAAT
TCAAAGGACTCTAAGGCTAAAATCTTCTTACTGTCTACACGTGCTGGTGGTTTAGGTATT
AACTTGACTTCTGCAGACACTATTTTCTTCACAGATAGTGATTTTAATCCTTATAGAGAT
GTCTAAGCCATTAGCAGAGCATATCGTATGGGTTAGGAATCAAAAGTAAAAGTATACAGA
TTAGTAAGTAAATACTCAGCTGAAGAGCGTATTATTGAAATAGCTACTAGAAAGCTCTTG
TTAGAATCAATTATTATCAATCCTATTAATAAATTCACTAAAGAAGATTTTGAAACTATT
TTAAAGAATGGTACTTATGAAATGTTTAACAAAAATTTAGAAGAAAAGGATTAAGAATTT
ACTGATGAGCAAATAGATGCTCTTATCAGTAGAGAAGGAGATATGATAAAAGGCACTGAT
GTTGAAAACGTATCCTTGCGTAAATCTGATCTTAATGATTACTATTTAAGTGGTTTTAAA
TTCAATTCATATAATTTCGAAACTGTTGATGAACGTCAAAAGCGTAATGATGAAGAAGAA
AAGTAAAAAGATTAGAAAAAGTATTGGGAAACACTTCTTGACGATCAAGCTAAATAACTA
CAAAGTCAACAAGCTAGTGAACTTGGTAAGGGTAAGAGAGTAAGAAAGATGATTAATAGC
ACTCTTCAAGATGATCATAATCGTACTAGTGATTCTTATTCTGAATTCGATGGAGAAGGT
GAAAAAGACAAAACTGTCTCAGAAAGTGATGGTGGCGCTGACGAAGTAGTTGAGAATTTT
GCTAAAAAGTAAAACTCTAAAAACAATAATACAGGAGCAGCTAGCAATGCAAATAATTAC
TTTTAGGAGGATCAATAAAACAAAGGATTAGTACACAAAAACAAAAAGACAACTGATAAA
ATATTAAAATATTTTGATGAAGAAATATATGCTAAATCACACATGAAATTTGCCAACATG
TCTGATATTGATCGTTTCTAGTTTGTACTTAATGGTTTTAATGAGTTCCATAGAATGGAA
TTCCTCTCTTTTATTCTTGAATTTGGTATGGATTTTAATACAATCGATTAATTCTGGCTT
GAACTCCAAAAGAACAGACCTGAAACTTTCAAAAAAGACCATAAGCCTACTTACATGGAT
TTCAAAAAGTATCTCAAGGAATTCTACGCAGCACTTTTATTCTATAAGAGATTAGAAAAG
CTTGACAATGCAGTGTTCTGTGGATTATCTCCTGAACTTGTTGTTAGAAGAATCGGAGGT
CTTTCAATTTTGCGTAAAAAGTACAACTATTTCACAAAAAAACCTGAGAAATTCAGAGTA
TCTCACAAAGAATATTCTTTCCATCAAGCCAAATTAGACGAAAACAATAAAATAGAATTT
TAAAAGTTTAAGTGGACTAATTACGATGATTATCTTTTAATTCATGCTATTTTTGCAGTA
GGATTTGGTAACTGGGAAAAGCTGTTAGAAAACAAGATTTTATGGGATTACCCTCAAGAT
CTTAATTTATAAATATGGTAAATTATTTTCCATAAGTTTGACGAAAAGGAAGACAGAGAT
ATCAATACAATCGATTCCGAACTAGGACAAAAGTACGTTATTAGGAAATTATAGAACAGA
GCTAACAACATGATGAATTTCTTGCTTGATGTAGATGAAGGAAAGAAGGAAGAATGA


>TTHERM_00049310(protein)
MQRYISIFYQINNTKEEENINYKKQPRKSKFTNKKRKKIQIKVIILIIIKIKHFKRNKEI
TDKHNINFLSTKDILIIKFKMGTRRRQQAVSNDESSSKQQEVTQRTLRTRTKKLKVVSDS
EDDLEDELDAQYDDEEEDFDDEAVRKPKSKKNLKKNSSIIKSGNGRGRKSKAKQKKNEDS
MQEEEEESIQGGEEDNNQAENEIEEEIEGNEQDDQAHDQGEYAEDDLEDEPPSDDYEYDS
EEKANKVQRDEVYNLSETDANESWCFICRDQGKLICCENCSKTFHLTCVGIKKPPTGAWE
CPYCREENKDICCACEKSTNEAEIKVTCSLCYRLMHFECLGIPLKQLVDCPMNRNYFLDA
DTLTILQSISDKDDAEVANEKLKNLTEAIKKLHTTEGKQILYSCFTCIGYFGIDKIQDYV
STEVGNCFITKLNNAAYIHSYWLPESVVERKIPRKLKNFKDKKKQVKVAIDEEEIEIALT
EEPVDVLEENIKIERIIDCKRPIKHAKRSYRDIYDSIFSKYGDLYEKQIVFGAKTNYKFL
IKWQGLFYDECTFEDEFIVLKYKEILRKYLQIKMFEETIGTPRFQEERENKRKINTQVQK
KYKQQPNFITGGSLHKFQIDGVNWLSESYNKANNVILADEMGLGKTVQTVSFLNYLYYEK
DIDGPFMVVAPASTLYNWLREFAIWGDKFNVLVYTGNQASRSLVRHREFYFKIKNPLKKG
KKKKDLVPKFNALITSYDTAINDAHFLRKIQWECLVVDEAHRLKNNESKFFKISSTIATR
HKVLLTGTPLQNNILELLNLIEFICPQKAKTMKNFESLKMFLQTTTTQTKQQQQQDEQIP
EAERKKALSELTKMLAPHLLRRKKTDVDLELPEMEEIIIKISLTDTQKYYYKNVLVKNYD
NLKLLDAKSKNFSKFSLLNILMSLRLVCNHPSLFLYKKKYLIPKKDKFQEEFVDCSNKLK
FLERMIPKLLQQNHKMLIFSQFTMMLDIMGEFFNFKGWAFERLDGTTSVIDRQKTIDSFN
SKDSKAKIFLLSTRAGGLGINLTSADTIFFTDSDFNPYRDVQAISRAYRMGQESKVKVYR
LVSKYSAEERIIEIATRKLLLESIIINPINKFTKEDFETILKNGTYEMFNKNLEEKDQEF
TDEQIDALISREGDMIKGTDVENVSLRKSDLNDYYLSGFKFNSYNFETVDERQKRNDEEE
KQKDQKKYWETLLDDQAKQLQSQQASELGKGKRVRKMINSTLQDDHNRTSDSYSEFDGEG
EKDKTVSESDGGADEVVENFAKKQNSKNNNTGAASNANNYFQEDQQNKGLVHKNKKTTDK
ILKYFDEEIYAKSHMKFANMSDIDRFQFVLNGFNEFHRMEFLSFILEFGMDFNTIDQFWL
ELQKNRPETFKKDHKPTYMDFKKYLKEFYAALLFYKRLEKLDNAVFCGLSPELVVRRIGG
LSILRKKYNYFTKKPEKFRVSHKEYSFHQAKLDENNKIEFQKFKWTNYDDYLLIHAIFAV
GFGNWEKLLENKILWDYPQDLNLQIWQIIFHKFDEKEDRDINTIDSELGQKYVIRKLQNR
ANNMMNFLLDVDEGKKEE


>TTHERM_00049310(gene)
ATGTAGCGGTATATCAGCATTTTTTATTAAATAAATAATACTAAAGAAGAAGAAAATATA
AACTATAAAAAACAACCGCGAAAGTCCAAATTTACAAATAAAAAAAGAAAGAAAATATAA
ATCAAAGTAATTATCTTAATCATAATAAAAATTAAGCATTTTAAAAGAAATAAAGAAATA
ACTGATAAGCATAATATCAATTTCTTAAGTACAAAAGATATATTAATTATTAAATTTAAG
ATGGGTACTCGTAGAAGATAGTAAGCAGTCTCCAATGATGAAAGCAGTAGTAAATAATAG
GAAGTGACTTAGAGAACGCTTAGAACAAGGACAAAAAAACTCAAAGTTGTTTCAGATTCA
GAGGATGATTTAGAAGACGAATTAGTAAACATTTCATTTTCACTCACTCACTCACTTCTC
CTCTTTTGTTTTTACTTTGATTTTTTTTTTTTTTGAGTATTCGTTTATCAGCACTTAATT
ATCTATATAGAAGTGCTTTCACAATAAAATAGCCTAAAGAGCGAAAAAATTGTAAGTACT
AAGATGATAATATCTACATGAACAAATGAAAGAAAGCAAATTAGTATTAAGCAAAGCAAA
CTTTTGAAGTATAAAGTGTTTTTTAATTTACGAAGATAGTATAATTTTTGTAAATCCATA
CTAAGATTTGTATTCAAGAATCATTTTAACAACACATTACATTTAAAAATACTAGCCTTA
TATATATTTTTAAATAAACACTACTTCACATTTCTAAAGAGATATAAAAGGAGGAGCTTA
ATTTCTAATATACCTCATATTAAATTATTAACGTAAAAAGGACGCATAGTATGATGATGA
AGAGGAAGATTTTGATGATGAGGCAGTGCGTAAGCCAAAATCTAAAAAGAATTTAAAGAA
AAATAGTAGCATCATAAAATCTGGTAATGGAAGAGGCAGAAAGAGTAAAGCCAAATAAAA
GAAGAATGAGGATTCCATGCAAGAAGAAGAAGAAGAATCTATTTAAGGAGGAGAAGAGGA
CAATAACTAAGCTGAAAATGAAATTGAAGAAGAAATAGAGGGTAACGAATAAGACGATTA
AGCTCATGATTAAGGAGAATATGCAGAGGATGATCTCGAAGATGAGCCCCCTTCAGACGA
TTATGAATATGACTCCGAAGAAAAAGCTAATAGTAAGAAAATTTTTATATAATCATAAAT
AGTAAAGTTTTGCACATCAATAAATCTTAAAATTTTGAGATAATGATTACTCCATATAAT
ATTTTAAATGACCAATTCATAATATCATTTAAGTAGGTTGTAAAATAAGTATAAAACCCA
TCTATAATTTTCATTGTATATTACAGACAAATAAAATTAAAAGAATTAGCTTAATTTATA
GATTCTTGCATGCATTTCAGAAATCAGCTTCAAGGGGAATCCATTTATGCAGAAAATATA
AAATTTTAAAATCAACAATGATATAGTTATTTTAATTCTATTGTTAAATTGCTTTGAGTT
TCTGCAAAATTAAATCTATAAGTATTGCAAAAATTCTGAATTTAATGGATAACGCAGATT
AAAAGTTTAGATTTATTATTGAGTAAAGCAGTATATTCAAATAGAGAGGGAGACTTTACA
AAGAAGCAATATATTAATAGGATAATTAGAAATAAAGGAATTTTAATTTAGTTTTGTAAA
TTGCTTAATTTTTATAGAGAGATGATTGATTATAAATAGACATAATATGAAATAAATTTT
AGAAAATGAATGAGAAGTTATTCATTTTAATTTAATTTATTAAGCAAGAAAATCAAAATA
AATAAAAACTACCATTGAGCATTAATTGCTGTAGCCTTTACTAAAATTTAGCCAAAACAT
ACTTATAGTAAGTAAATGGAAATTAAAAATAAGGAAAATAAAATTTATTATGAAATTATA
ATTTGGTTTTGTATGAAGAAGTGCAATTAATAAGAAAAATGATGTTTATATATTCCATTG
AAAAATAAAAGAAATTATACGAAAAGGTTTGAATATTATTTAAAAGAAAAAAAAAATTCA
TAGGATTCTAAATTTTTTTTAAGTAAGAAAAAATGCATTTATTTATTTATTGCTTAGTTT
GATAAAAATTCAATCGGAAAAAATAAAAAATAAAAAGTGGAAAGAGTAGTACTTAAAAGG
TTAAAAAGAGAGGCGAAATAAATGAGGTAGATCAGAATATTCAATTTTTCAATGATGAAA
AGCATATTAATAAAATTTAAGACTTGCTTAGGAAAAATTAATAATACGTCATTTCGAAGA
AAAAAGAAAGTGAGGTTGCATCACTTACTTTCAAACATTATCGAATATAATGTTTTTTTT
TAAATTTTGCTGACTGACTGATTTCCAAATAAAAAAAAATTTAGAACCCAATAAATAATT
AATACTTAATAAAAATTAGTTAGCTTATTAGCTAGTATTTTAAAATTCTTATTAAATCAT
CTCCCATTTATTTATCTATTTACATTTTTCAATCTTCATTAAAAATATTTTTTTCTTTCT
CAACTTAATTAATAATCAAAAATGAAGGAAAAAAAAATTTTTAATAAATAAACTAAAATG
ATCATTTGATTAAAACATCAACTAAATTATATAAATGGAGTCATTGATTTTATTTGTGCA
ATACCGATAACCGTTAATAAAGAAGGATTTTTATTTATAAAATTTTTTATTACAATCAAT
TAGAGGTATAACGTGACGAAGTGTACAATCTTTCAGAAACAGATGCAAATGAGAGTTGGT
GCTTTATTTGTAGAGATTAGGGAAAACTTATATGCTGTGAAAATTGCTCAAAAACATTCC
ACTTGACTTGTGTGGGTATTAAAAAGCCTCCAACTGGTGCTTGGGAATGTCCTTACTGCA
GAGAAGAAAATAAAGATATATGCTGTGCATGTGAAAAGAGTACTAATGAAGCTGAAATTA
AAGTTACTTGTTCCCTTTGCTATCGTTTAATGCATTTTGAATGTTTAGGTATTCCTCTTA
AATAGCTCGTAGATTGTCCAATGAATAGAAATTATTTTTTGGATGCAGATACTCTTACTA
TATTGCAATCAATTAGTGACAAAGATGATGCAGAAGTAGCTAATGAGAAGTTAAAAAATT
TGACTGAAGCCATTAAAAAGCTTCATACTACTGAAGGTAATATTAAGATAAATTTATTAT
AAATATTAATAATATTACCATTAATTAGGAAAATAAATTTTATATTCTTGCTTTACTTGC
ATAGGCTATTTTGGAATAGATAAAATTTAAGATTATGTCTCAACTGAAGTTGGCAACTGC
TTTATCACAAAATTAAATAGTAAATTTTTTTTTAACAAAGAATGAAAAATAATTTTTCAA
ATTTTTTTAGATGCTGCTTATATCCACAGTTATTGGTTACCTGAGTCTGTAGTTGAAAGG
AAAATCCCAAGAAAACTTAAAAATTTCAAAGATAAGAAAAAATAAGTTAAAGTTGCAATT
GATGAAGAAGAAATAGAAATAGCATTAACTGAAGAGCCTGTTGATGTTTTAGAAGAAAAT
ATAAAAATAGAAAGAATTATTGACTGCAAACGTCCTATAAAGCATGCCAAGCGTTCATAC
AGAGATATTTATGATTCTATATTCAGCAAATATGGAGATTTATATGAAAAATAAATTGTC
TTTGGAGCAAAAACAAATTATAAATTCCTTATCAAGTGGTAGGGACTCTTCTATGATGAA
TGTACTTTCGAAGATGAGTTCATAGTTCTTAAATACAAAGAAATTTTAAGAAAATATTTG
TAAATAAAGATGTTTGAGGAAACTATTGGTATTTATTATTTATTGTTAGCAAAATTTTTA
AACTCATTTATTTGTATCTGATAAAAATAATTAGGAACTCCAAGATTTTAAGAAGAAAGA
GAAAACAAAAGAAAAATAAACACTCAAGTATAAAAGAAGTATAAGCAATAACCTAATTTT
ATCACAGGTGGTTCATTACACAAGTTTTAAATAGATGGTGTTAATTGGCTTTCAGAAAGT
TATAACAAAGCAAACAATGTTATTCTTGCAGATGAAATGGGTCTTGGTAAAACTGTGTAG
ACTGTTTCTTTCTTAAATTATTTGTACTATGAGAAAGATATTGATGGACCTTTCATGGTA
GTTGCTCCTGCCTCCACATTGTATAATTGGCTGAGGGAATTTGCCATTTGGGGAGATAAA
TTCAATGTACTTGTGTATACTGGAAACTAAGCTTCTCGTAGCTTGGTCAGACATCGTGAG
TTTTATTTCAAAATCAAAAATCCCCTTAAGAAGGGCAAGAAGAAAAAAGATTTAGTACCT
AAATTTAATGCATTGATTACAAGTTATGATACAGCTATCAATGATGCTCATTTCTTAAGA
AAAATTCAATGGGAATGCTTGGTTGTTGATGAAGCCCACAGACTTAAAAATAACGAATCT
AAATTCTTTAAAATCTCATCAACTATCGCAACAAGACATAAAGTTCTATTGACAGGTAAT
TAAATAAATAGAATTATTTTTAATGCATAAAAACTAAAATAATTTTTCTTTAATTTAAAG
GTACTCCCTTACAAAATAATATATTGGAATTACTCAATTTAATCGAATTTATCTGTCCTT
AGAAGGCTAAAACAATGAAAAATTTCGAAAGCTTAAAAATGTTTTTATAAACAACAACTA
CATAAACTAAATAGCAATAGCAATAGGATGAGTAAATACCTGAGGCTGAACGAAAGAAGG
CCTTAAGTGAGTTAACTAAAATGCTTGCTCCTCACTTGTTGCGTCGTAAAAAAACAGATG
TCGATTTAGAATTGCCTGAAATGGAAGAAATTATTATTAAGATCTCTTTAACTGATACCC
AAAAGTATTACTATAAAAATGTATTAGTCAAGAACTATGATAACTTGAAATTACTTGACG
CTAAATCTAAAAACTTCTCTAAATTTTCTTTACTTAACATTCTTATGAGTTTACGTCTTG
TTTGTAATCATCCTTCCCTTTTCTTATACAAAAAGAAATATCTCATTCCTAAAAAAGACA
AATTCTAAGAAGAATTTGTTGATTGTTCAAATAAACTTAAGTTTTTAGAACGTATGATTC
CTAAACTTTTGTAATAAAATCACAAAATGCTTATTTTCTCATAATTCACAATGATGCTTG
ATATTATGGGAGAATTCTTTAACTTCAAAGGATGGGCTGTAATTAATTAATTATTTATTT
ATTTATTTATTATTTTAACTATAAATTTTATTAACTCTATATTTTTTAACTTTTAGTTTG
AAAGACTTGATGGTACAACCTCTGTCATCGACCGTTAAAAAACTATTGACTCTTTTAATT
CAAAGGACTCTAAGGCTAAAATCTTCTTACTGTCTACACGTGCTGGTGGTTTAGGTAACT
TGCAAAATATTAAATTAGTTTACTTATTTTTAAAACTAAAAAAATCTATTTAGGTATTAA
CTTGACTTCTGCAGACACTATTTTCTTCACAGATAGTGATTTTAATCCTTATAGAGATGT
CTAAGCCATTAGCAGAGCATATCGTATGGGTTAGGAATCAAAAGTAAAAGTATACAGATT
AGTAAGTAAATACTCAGCTGAAGAGCGTATTATTGAAATAGCTACTAGAAAGCTCTTGTT
AGAATCAATTATTATCAATCCTATTAATAAATTCACTAAAGAAGATTTTGAAACTATTTT
AAAGAATGGTACTTATGAAATGTTTAACAAAAATTTAGAAGAAAAGGATTAAGAATTTAC
TGATGAGCAAATAGATGCTCTTATCAGTAGAGAAGGAGATATGATAAAAGGCACTGATGT
TGAAAACGTATCCTTGCGTAAATCTGATCTTAATGATTACTATTTAAGTGGTTTTAAATT
CAATTCATATAATTTCGAAACTGTTGATGAACGTCAAAAGCGTAATGATGAAGAAGAAAA
GTAAAAAGATTAGAAAAAGTATTGGGAAACACTTCTTGACGATCAAGCTAAATAACTACA
AAGTCAACAAGCTAGTGAACTTGGTAAGGGTAAGAGAGTAAGAAAGATGATTAATAGCAC
TCTTCAAGATGATCATAATCGTACTAGTGATTCTTATTCTGAATTCGATGGAGAAGGTGA
AAAAGACAAAACTGTCTCAGAAAGTGATGGTGGCGCTGACGAAGTAGTTGAGAATTTTGC
TAAAAAGTAAAACTCTAAAAACAATAATACAGGAGCAGCTAGCAATGCAAATAATTACTT
TTAGGTACTTATTTATTTATTTATTTAAATATTTATTTATTTATTCATTTAAAATTATTT
TTACTTTTTTAGCTTTTTCGACAAGCCAATTTTTTCAAATTTTTTATATAAAAATAATTA
ATAAATAATATTTTATTTAATAAATAAATAAATAATTAGGAGGATCAATAAAACAAAGGA
TTAGTACACAAAAACAAAAAGACAACTGATAAAATATTAAAATATTTTGATGAAGAAATA
TATGCTAAATCACACATGAAATTTGCCAACATGTCTGATATTGATCGTTTCTAGTTTGTA
CTTAATGGTTTTAATGAGTTCCATAGAATGGAATTCCTCTCTTTTATTCTTGAATTTGGT
ATGGATTTTAATACAATCGATTAATTCTGGCTTGAACTCCAAAAGAACAGACCTGAAACT
TTCAAAAAAGACCATAAGCCTACTTACATGGATTTCAAAAAGTATCTCAAGGAATTCTAC
GCAGCACTTTTATTCTATAAGAGATTAGAAAAGCTTGACAATGCAGTGTTCTGTGGATTA
TCTGTACGAAAAAAAAATATGTCAAAATAGATTTTATTTATATTATTTTTTTTTATTTAA
AAAAGCCTGAACTTGTTGTTAGAAGAATCGGAGGTCTTTCAATTTTGCGTAAAAAGTACA
ACTATTTCACAAAAAAACCTGAGAAATTCAGAGTATCTCACAAAGGTAATTTAATATTTT
TAAAAAAATGCAAATAATAATGTTAATTGTTTAATCTAAACAGAATATTCTTTCCATCAA
GCCAAATTAGACGAAAACAATAAAATAGAATTTTAAAAGTTTAAGTGGACTAATTACGAT
GATTATCTTTTAATTCATGCTATTTTTGCAGTAGGATTTGGTAACTGGGAAAAGCTGTTA
GAAAACAAGATTTTATGGGATTACCCTCAAGATCTTAATTTATAAATATGGTAAATTATT
TTCCATAAGTTTGACGAAAAGGAAGACAGAGATATCAATACAATCGATTCCGAACTAGGA
CAAAAGTATGAATAAATTTATTATTTCTAACAGGTTTGTATTTTAATTTTATGAATAATA
AATTTAATATAGGTACGTTATTAGGAAATTATAGAACAGAGCTAACAACATGATGAATTT
CTTGCTTGATGTAGATGAAGGAAAGAAGGAAGAATGA