Identifiers and Description

Gene Model Identifier

TTHERM_00193800

Standard Name

CHD1 (Chromo-Helicase-DNA-binding domain)

Aliases

PreTt06663 | 16.m00319

Description

SNF2-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00628 ) PHD-finger
  • ( PF00439 ) Bromodomain
  • ( PF00320 ) GATA zinc finger
  • ( TIGR01612 ) rhoptry protein
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( TIGR01784 ) conserved hypothetical protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF06304 ) Protein of unknown function (DUF1048)
  • ( PF07599 ) Protein of unknown function (DUF1563)
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain
  • ( PF00130 ) Phorbol esters/diacylglycerol binding domain (C1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 27.3%

TetraMine Data

TTHERM_00193800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_340110
Tetrahymena borealisEI9_03657.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (2156 aa)
OxytrichaContig11634.0.g759.997093137033517e-262SNF2 family N-terminal domain
DictyBaseDDB_G02807055.998685392774004e-165chdB on chromosome: 3 position
3648861 to 3656137
WormBaseWBGene000070531.9992336839414155e-150locus:chd-7 status:Partially
_confirmed UniProt:O61845
protein_id:CCD61264.1
SGDYER164W3.998306063536528e-116CHD1 Nucleosome remodeling fac
tor that functions in regulati
on of transcription elongation
; contains a chromo domain, a
helicase domain and a DNA-bind
ing domain; component of both
the SAGA and SLIK complexes

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9115421: Tsukiyama T, Wu C (1997) Chromatin remodeling and transcription. Current opinion in genetics & development 7(2):182-91
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00193800(coding)
ATGGAAATCTATTAATTTTATCAATTGAATAATCAAATTATTTGTTTGCTATTATTTTTT
ATGATAAAGATAATTAATTAATTATATGGTTAATGCTATAAAAATTCATAGCAATTAGCT
TATGCCTTTTCATTAATTAAGTCTTAGATTTTTTATTAAGTATTAGCTGAATTTTCAATC
ATCATATATAATCAAATTCTCAAGCAATTATAAAGAAATAATTGGAATAAAATTAAAGAG
GAAAAGAACAAAAGAAAAAATATATATAAAGAAATAAAAAAAAAGATTAAAAAATAAAGA
AAAAATAATTAGATGTCAGGATCTGAGGATTCAATTGAAAATCAAAGTTCATTTGATGAT
GATAGTTATTCAGACGGACGTCTTCCTCGCTCATCTAAGAGAAAGGGAAGAAAACCAAAA
TCGTAAGCCATTAAAGAAGAAGATGGAGCAGATGGTGAATTGAATGAAGAAAGGGATGTC
AGAAAAAGGCAAACAAGATAGAAAGTCACTAATGGCATTAAGAGTCTCCTTGAATAGGAA
AGAGATGTAGATTAGTAAATTCTGGAAGCAGAATAAGAAGAAGCAGCTGCAGCTGCATAA
GCAATGGAAAATGATGAAAATGCTGGAAGCGAACCAGGCGGAATTTTTTATCCAGAGATA
GATTAAATACTTTGGAAGCGTTTTAAAAAGGGTTCAGAAAGCGAATATGAGTATCTAGTG
AAGTACAAAGAGTACTCTTACCTTCATTGTGAATGGTTAGAAGAAAAAGATGTTATAGGT
GATTCAAAGTCTGGAAAAAATAAACTCAACAGATTCAACAAAAATTTTGAAAAAAAGCTT
CACGACGGTGATTTCGATGAAGATGCAGAGGAGAATGAAAGATATTTTGATCCTACCTAT
ATAGAAGTAGACCGTATTCTACAATGCGTAGAACTTTTCCCAATAATACATCCTAAAAAG
GCTAATGAAATTAAAGGTAAATGGAGCGAATTGCTTGTAGTCATAATACAAAAGCTCTTG
AATTTTACAAAGGACGATGTGCATTATGGTATTTATTTTATGGAACCAGTTAATCCTGAA
CGTGATAATTGCCAAAATTATAAAAAAATTATCACTAACCCTATGGATCTTGGAACTATT
AGCAATAGATTGTATTTAGATTATTATAAGAGTTTCTAACACTTCTTTTAAGATTTTGGC
TTAATATTTAAGAACTGTAGAAAATACAACAAAGATCCTGAATCAGACATTAGAATTCTT
TGTGATACTCTTCGTGAAGCAGGTATAATCCTATATGATGAATGGTTCTAAATTCAGAAA
AAGATTTATGAATTACTAATTAAAGACTTTAATTAAATGAATGATCCCGAGTATATCAAA
AAGAAAGAAGAAGAGAAGAAAATTGAAATTTAAAAGTAAGCTTAGAAAAGAAAAAAGACA
TTTTAAAAATAAACCATCACCCTCACAAAGAAGCTAATTGAAATATAGCAAAAAATAAAG
AAGGCAGAAGAAGATGAATTAGAAGGAAAGCTTAAAAGTGAATAAGAAGAAAAGGATTAA
GCCCAAGATAAAATGGATGTTGAAGGAGAAGAAGGCATTCAAGCAAGTGATAAAAAAGTA
AGAAGACCTCGCTTTAGCTTGATTGATGAAATGAAGCTTTTTTCTGCAGAACATTAAGAA
GAAATAAGCAATAACTTAACTTTAAAAGACATTGATATGAAGGAAGAGCATGAAATTAAA
AATGTTATCAATATCTTCATTTAAGCTAATAAATTCTTGCTGGATGTAGAATTCTCAGAT
GATGAGGATGCTAAATTAGAAAATGATGAAAATAAAATTAAATCAAGCTGTGTAGGAGAT
GAAAATGAAGAAAACTAGCTCTCAGAAGAATAAAAAGCTGAAAAACGTAAAAAAATTCGT
GAAGAAGCTGTAGCAAAATATATCGATGCCATGTTCTAGTCAATAAAAAATCGCCGTAAA
AAAGGATCAGTTGTAGACTTGACTCTTGAAGAAATCGAGAAATACAATCCAGGTAAATAT
AATTATAATTGGTTGGCAGATGAAGGACTTAATTCTGCAAGCGTTGAAGAGGAACTCTCT
GTATATATTTCTGCAGAAGAAGCTGATGCATTATCTCTTTCAGTTGAGATAGATACCTTA
TATCTTGTGAAATGGAAAAATTTATCTTATCTTGAAAGCACTTGGGAACACGAGAGCATT
ATCGCTAATCAGACTAAGATAAATGACTATCGTATGTATAATCGTGCCCTTGATAAGGAA
TCTCGTCAAGTTTTAAGTTAATAACTTGAGCGCCACAAAACATTACTTGATCTAGAGTAA
AACCCAAAGAAAAAGTAGAAGATTGGTCCATAAGGACTTATTGAATTAAAAAATAAACTC
TTTTTCTATGATGTTGCTAATTACAAATAGCCATTTTAATATACATAAAAGACACAACCT
ATCTATAAATAGAGAAAACTCCTTCGTTATTATTAATTAGAGTCTCTCAACTGGATGATT
GAAGCTTGGTATAGTAAAAGAAATGTTATTTTAGCTGATGAAATGGGTCTCGGTAAAACT
ATTTAATCCACTGCTTTTATTAATCACCTTTACACTTTTGAAAATGTTCGTGGTCCTTTC
CTAATTATAGCTCCTCTGAGTACTTTAGAGCACTGGAAGCGTAGTGTAGAAGATTGGACA
AATTTAAATGCTGTTCTTTACTATGACCACTCTGGTTAGGAAGGCCGTAATTGTTGTAGA
TTCTACGAATGGCTATATACTGATATCTCTACTAAAGGTACTGTATTATAATCAAATGAA
ATCTACAAATTCTAAGTCTTAATCACTTCAAATGAAGTATTCTTGAGTGATACCAATAAT
TTCCTCATAAATATTCCCTTTTAATTTATTGTTGTCGATGAAGCTCACAGACTTAAAAAT
CAAAATGCAAAAATTTTAGCAACATTAAAACGCTTACCTTGCAAGCGTACACTCCTTTTA
ACAGGTACTCCTATTTAAAATAACACAGAAGAACTATGGACTTTGCTTAATTACATTGAA
CCAAACAAATTTGCAAGTCTTCAAGAATTCAAAGAATAGTTTGGTGAGTTACAAAACAAA
GAATAAGTAGATAATTTGCAAGTAAAAATTAAACCATTTTTACTGAGACGTATGAAAGAA
GATGTAGAAGACAGTATTCCTCCTCTTTAAGAAACAATTATAGATATTGAAATGACTACT
CTCTAAAAAACTCTTTATCGTGCTATCTATGAAAGAAATAAAAGTATGCTCCAAAAGAAT
TTTTCATCTATGGCTATGAATACTTCACTTAACAATTTAGAAATGCAACTCAGAAAATGT
TGCAATCATCCTTTCTTAATTAAAGAAATGGAAATAGAACTCACCCAAAATTTTAAAACT
TCTGAAGAGCGCTATAAATGCCTTGTTGATACTTCTGGTAAAATGATTTTACTTGATAAG
CTCGTTCAGAAATACAAAATTGAAGGAAAGAAGATTTTGATTTTCTCTTAATTCGTTTAT
ATGCTAAACTTACTTGAAGAATATCTTCGTTATCGTTAACTTAAGTATGAGAAAATTGAC
GGATCAGTTAAATCTAAAGAGCGTTAGAATGCTATTGATCGCTTCAATGACCCTGATAAA
AAGCGTGATGTTTTCTTACTTTCAACTAAAGCTGGTGGTCTTGGTATTAACTTGACATCT
GCAAATATTGTAATAATATTTGATTCAGATTGGAATCCTTAAAATGATGTCTAAGCTACT
GCTCGTGCTCATCGTATTGGCCAAAAATAAGAAGTTATGGTCTATCGTTTTATCACAAAA
AAAACTTACGAGGCTGAAATGTTTGAACGTGCTACTAAAAAGCTAGGATTAGATTAGGCT
ATATTTATGGGTGGTGAGTTCAAATCAGTCTAAGGTAACAAGGATGAATCTAAGAAGCTT
GGTAAAAATGATGTAGAAAGTCTTCTGAAAAAGGGTATTCTTGGTTTGGTAAATGAAGAA
GAAGAAAACAAAAAATCTAATGAATTTTAAGAAGAAGATATTGATATGATTTTAAAGAAC
AATACTCGTATTGCTAAGTATTCGGTCATAAATGGCAGCTATAGTTTCAGCAAAGGTTCA
TTCATATCCAACAAGGCAGATACTGACCTCAAGATTGATGATCCTAATTTTTGGAATAAA
GTATTAAAAGACTAAGAAAGTAAGACTTTATTGGCTCTTAAAGAATATGATGAGCGCTCT
AAAATACTTTCTGTTGATGTTGAAGAATAAAAGAAATATTTCTTTAAAGTTTGTGAATTT
GTAAATGATCTTATTTCAAGTAAATTGAGCTTAATTGGCTACAATGCTGATGATGAAAAA
AATATTACCGATATTTTAAATAAAATTTCTGATAGTAAAGACTTCCATACTAAATATAAA
GATCTTGCAATGAATTTTATTTATGAAGTCTCTCGCCCCTCTCGTCGTTTCCGTAAAGTT
ACCTTGCAAGATTTGGATGTTACTAATCCAGAAAATCAGAAATCTAAAAAGAATATTTCC
AATTCTTCTGACGAAAATGATCTCTTTTATGATGGATACTCAGATTTAGAATCAGATGAA
TTAGGCGTTGGTTCTGTAAATAACTTCCCATCAGAAAAAAAGACTGGAAGTAAAGACAAA
GAAAAAAGTTCAGAAAATGGTGGCAGCGGAGTAAGTAAAAAAGAAGACCTCTTCAAGAAA
TTATGCTATTATTGCGATCGCCCAAAATGCACTGTATTCTGTTAAGGTCATTGTAAGAGA
TCATTCCATAGTGAATGTAAAGAGAGAGTAGAAGCAGGATGGATTAATGAAAATGGTATG
ACAAGCGAAACTAGAATCGTACCTACTGAGGATCATTACGATGAAGAACGTCTTAAAAAA
ATGTTAAATATTAACTATACATGCAAGGATTGTGAAGCAAATACAGCTATCTGCTTTATT
TGCAAAAAAAAAGGAAGTTTCTTCCCTCCTGCCGTTTTAAATAAATAAAATAAGCGTATT
TAATAATAAAAATAAAAAATTATTGCAGAGAAAGAAAAGCAAAAGGACCCATCTAATGAA
ATAGTTGAGGAATCTGAGAATGAATTAGATGAAGATTATGACTTGGTTGAAGATGATTCA
GTATCATAAAAAACAAGTGATTTGACAAAATGCTCAACTGCTAATTGTAATAAATTTTAC
CATCCTGTTTGTATTAAGCCTTATGCCTTATTCAAGTACATTGATTCAAATAATAAACGT
TTCCGTTGCCCATTACATTATTGTGCTCATTGCTTTATTTCTGGAGATTCTATGGCTATT
TCTTAATGTGTTAGATGTCCTAAAGCCTATCATCTTCGCTGCTTTGAAAAAGCTAAGGTC
CTGAAACTTACAAAAAAACTTATGCTTTGTGAAGATCACCCTCATTAATATTATAAAAAC
ATACATTCTAGCAGCGGATCTAATTCAAATAATAAAAATAGCTCATCATAATCAAATAAC
AACAACAATAATAATAATAGCAGATAGTAGAGTTCATAAAATGTATCTGCTAGTAACACT
AATACTAGATCCAAATCTGGTGCAACAAATAGCAACGATAACATTGTTGATGATACTTAA
CAAAAGAAATAAAAATTAAATAATGGTACAGGATAAGTAAGCACAAATAATAAAACTTCT
TCAAATAATTCATCCTAATAAAATGGTGTTAATTAAGCAAAGGAAGCTCTGGAAAAAGCC
ACTTAACCAGCAGCAAATTCTAATCAATCTTAAGCAAATACTTCTGGAAGAGAAGGTAGA
ATGACTCGTTCTCAAGAAAAAAATATTCAAAATTAACAATCCACAATTAGTTAATTCTTT
GGAAAAAAAGACAATAAACTTAAAGAAAAGTAAGACTAAAAAAATGTAAAATTAGAAGAT
TAAATAAATTAAGAAGGAGATGACTTAAATAACAGTCAAAATAATGGAAACTTAGAAAAC
GGAGAATAAGAATAGACTGTTGCTCCTAAACCTAAAGCTAAAAAGCCTGCTCCTCCCCCT
CCACCACCACCAAAAGAGCGTGAACCTCCTTAATTTTCATATGAAGACTTTAAGATCCCA
TCACAAAAAGACTTTGACTACCAGAAATATCAAAGGGATTGGTGCAGATATTGTGGTGCA
AGATTCTCAAGCAATTTCACAAAAGGACCATGGGGACCTAGAACACTCTGCACAGTTCAT
TATATAGCATGGAATCAAAAGAAGAAGTTGGATTTAAGGGCTTATAAAGAACTACCTACT
AAACCTATAAATCCTGATGACTAAACTGAGCTACATTTTATGAGTAGACTAAAATAAAAG
GATGAGTCTTACAATCCAGAGATTCTTTTGAAGGAGATGATGAATATTAATCTTAATGGC
CTCTCATCTTTGAATAGCTAAGAATTGAAAGATGTAAATTAGGATAGTAACTCTGGTAAA
GCTTCAAGTTCAGAAAAATAGGAATCAAAAAAAGAAACACCTGCCTCTAACACAAATAAA
AATGAAACAAAGACAGAGGAAGAAGATGGCTAAAAAATAAACAAGGTTTGA


>TTHERM_00193800(protein)
MEIYQFYQLNNQIICLLLFFMIKIINQLYGQCYKNSQQLAYAFSLIKSQIFYQVLAEFSI
IIYNQILKQLQRNNWNKIKEEKNKRKNIYKEIKKKIKKQRKNNQMSGSEDSIENQSSFDD
DSYSDGRLPRSSKRKGRKPKSQAIKEEDGADGELNEERDVRKRQTRQKVTNGIKSLLEQE
RDVDQQILEAEQEEAAAAAQAMENDENAGSEPGGIFYPEIDQILWKRFKKGSESEYEYLV
KYKEYSYLHCEWLEEKDVIGDSKSGKNKLNRFNKNFEKKLHDGDFDEDAEENERYFDPTY
IEVDRILQCVELFPIIHPKKANEIKGKWSELLVVIIQKLLNFTKDDVHYGIYFMEPVNPE
RDNCQNYKKIITNPMDLGTISNRLYLDYYKSFQHFFQDFGLIFKNCRKYNKDPESDIRIL
CDTLREAGIILYDEWFQIQKKIYELLIKDFNQMNDPEYIKKKEEEKKIEIQKQAQKRKKT
FQKQTITLTKKLIEIQQKIKKAEEDELEGKLKSEQEEKDQAQDKMDVEGEEGIQASDKKV
RRPRFSLIDEMKLFSAEHQEEISNNLTLKDIDMKEEHEIKNVINIFIQANKFLLDVEFSD
DEDAKLENDENKIKSSCVGDENEENQLSEEQKAEKRKKIREEAVAKYIDAMFQSIKNRRK
KGSVVDLTLEEIEKYNPGKYNYNWLADEGLNSASVEEELSVYISAEEADALSLSVEIDTL
YLVKWKNLSYLESTWEHESIIANQTKINDYRMYNRALDKESRQVLSQQLERHKTLLDLEQ
NPKKKQKIGPQGLIELKNKLFFYDVANYKQPFQYTQKTQPIYKQRKLLRYYQLESLNWMI
EAWYSKRNVILADEMGLGKTIQSTAFINHLYTFENVRGPFLIIAPLSTLEHWKRSVEDWT
NLNAVLYYDHSGQEGRNCCRFYEWLYTDISTKGTVLQSNEIYKFQVLITSNEVFLSDTNN
FLINIPFQFIVVDEAHRLKNQNAKILATLKRLPCKRTLLLTGTPIQNNTEELWTLLNYIE
PNKFASLQEFKEQFGELQNKEQVDNLQVKIKPFLLRRMKEDVEDSIPPLQETIIDIEMTT
LQKTLYRAIYERNKSMLQKNFSSMAMNTSLNNLEMQLRKCCNHPFLIKEMEIELTQNFKT
SEERYKCLVDTSGKMILLDKLVQKYKIEGKKILIFSQFVYMLNLLEEYLRYRQLKYEKID
GSVKSKERQNAIDRFNDPDKKRDVFLLSTKAGGLGINLTSANIVIIFDSDWNPQNDVQAT
ARAHRIGQKQEVMVYRFITKKTYEAEMFERATKKLGLDQAIFMGGEFKSVQGNKDESKKL
GKNDVESLLKKGILGLVNEEEENKKSNEFQEEDIDMILKNNTRIAKYSVINGSYSFSKGS
FISNKADTDLKIDDPNFWNKVLKDQESKTLLALKEYDERSKILSVDVEEQKKYFFKVCEF
VNDLISSKLSLIGYNADDEKNITDILNKISDSKDFHTKYKDLAMNFIYEVSRPSRRFRKV
TLQDLDVTNPENQKSKKNISNSSDENDLFYDGYSDLESDELGVGSVNNFPSEKKTGSKDK
EKSSENGGSGVSKKEDLFKKLCYYCDRPKCTVFCQGHCKRSFHSECKERVEAGWINENGM
TSETRIVPTEDHYDEERLKKMLNINYTCKDCEANTAICFICKKKGSFFPPAVLNKQNKRI
QQQKQKIIAEKEKQKDPSNEIVEESENELDEDYDLVEDDSVSQKTSDLTKCSTANCNKFY
HPVCIKPYALFKYIDSNNKRFRCPLHYCAHCFISGDSMAISQCVRCPKAYHLRCFEKAKV
LKLTKKLMLCEDHPHQYYKNIHSSSGSNSNNKNSSSQSNNNNNNNNSRQQSSQNVSASNT
NTRSKSGATNSNDNIVDDTQQKKQKLNNGTGQVSTNNKTSSNNSSQQNGVNQAKEALEKA
TQPAANSNQSQANTSGREGRMTRSQEKNIQNQQSTISQFFGKKDNKLKEKQDQKNVKLED
QINQEGDDLNNSQNNGNLENGEQEQTVAPKPKAKKPAPPPPPPPKEREPPQFSYEDFKIP
SQKDFDYQKYQRDWCRYCGARFSSNFTKGPWGPRTLCTVHYIAWNQKKKLDLRAYKELPT
KPINPDDQTELHFMSRLKQKDESYNPEILLKEMMNINLNGLSSLNSQELKDVNQDSNSGK
ASSSEKQESKKETPASNTNKNETKTEEEDGQKINKV


>TTHERM_00193800(gene)
ATGGAAATCTATTAATTTTATCAATTGAATAATCAAATTATTTGTTTGCTATTATTTTTT
ATGATAAAGATAATTAATTAATTATATGGTTAATGCTATAAAAATTCATAGCAATTAGCT
TATGCCTTTTCATTAATTAAGTCTTAGATTTTTTATTAAGTATTAGCTGAATTTTCAATC
ATCATATATAATCAAATTCTCAAGCAATTATAAAGAAATAATTGGAATAAAATTAAAGAG
GAAAAGAACAAAAGAAAAAATATATATAAAGAAATAAAAAAAAAGATTAAAAAATAAAGA
AAAAATAATTAGATGTCAGGATCTGAGGATTCAATTGAAAATCAAAGTTCATTTGATGAT
GATAGTTATTCAGACGGACGTCTTCCTCGCTCATCTAAGAGAAAGGGAAGAAAACCAAAG
TAATTAAGGCCTCCCATTTTATATCAATTTCTTAAAACAAGCCAAGCCCTTCCTTTCCTT
CTCAACCTTCACTCTTACTTCCTAGCTATATAGGAATCTTTGATATATTCTCCCCACTCT
ATTTTTATCTTGAATTTTACAAAGTTATTTATTCATATTAATTGGTTTTTTTTTTTTTTG
ATTTAAGTGCTTTTATAATAAGCACCTTTGCATAAAAGCGATGATAAAAAAGTAATACTA
GGAGGGAAGTGGCGCGAAAAGAAATAAATTTTTAAATAAATCTAAATAAATATAGATCGT
AAGCCATTAAAGAAGAAGATGGAGCAGATGGTGAATTGAATGAAGAAAGGTACATTACAT
TTATATAGGATTATTTTTTTCAACTTGCAGCTAAATTACTCTTTTAGTGTTGATTTGTTT
ATTTGCATAGTCAATTAATCATATCAAAAATTACATAGAAGCAATAAAAAAGGAATAAAA
ATTTGAATACTTCATTTTATGCATAAAAAAGGGATGTCAGAAAAAGGCAAACAAGATAGA
AAGTCACTAATGGCATTAAGAGTCTCCTTGAATAGGAAAGAGATGTAGATTAGTAAATTC
TGGAAGCAGAATAAGAAGAAGCAGCTGCAGCTGCATAAGCAATGGAAAATGATGAAAATG
CTGGAAGCGAACCAGGCGGAATTTTTTATCCAGAGATAGATTAAATACTTTGGAAGCGTT
TTAAAAAGGGTTCAGAAAGCGAATATGAGTATCTAGTGAAGTACAAAGAGTACTCTTACC
TTCATTGTGAATGGTTAGAAGAAAAAGATGTTATAGGTGATTCAAAGTCTGGAAAAAATA
AACTCAACAGATTCAACAAAAATTTTGAAAAAAAGCTTCACGACGGTGTAAGCAGCTTAC
TCTATTAACTTATATTTAATTTTGGATTTATTTAAAAAATGGCTAACAAATATATTTATT
TTTTCAAAACTCAGTCAATTACAATAAATTAGTGAAATGAGATGCCGATTGTTCTATGCA
AAAGATAAGACAAAATAAGATTTAAAAAGTGGAATTTCAACTTAGCATTCAAAACACGAA
ATATCCAGTAACCAAACTGATATTTCGAATATTATCGTTAAAATAAACCTTGCAAAGAAA
CATAACTCATTTAATAGCAAATTAGCCAAAATATTTTCCAATCCGATTCCAAACAGTAAA
ATTAAATTATTTTCTTTATAATTAGGATTTCGATGAAGATGCAGAGGAGAATGAAAGATA
TTTTGATCCTACCTATATAGAAGTAGACCGTATTCTACAATGCGTAGAACTTTTCCCAAT
AATACATCCTAAAAAGGCTAATGAAATTAAAGGTAAATGGAGCGAATTGCTTGTAGTCAT
AATACAAAAGCTCTTGAATTTTACAAAGGACGATGTGCATTATGGTATTTATTTTATGGA
ACCAGTTAATCCTGAACGTGATAATTGCCAAAATTATAAAAAAATTATCACTAACCCTAT
GGATCTTGGAACTATTAGCAATAGATTGTATTTAGATTATTATAAGAGTTTCTAACACTT
CTTTTAAGATTTTGGCTTAATATTTAAGAACTGTAGAAAATACAACAAAGATCCTGAATC
AGACATTAGAATTCTTTGTGATACTCTTCGTGAAGTAATTCTGATTAAATATATTAAACA
ACTACTCAAACCTTTTTGATTTAATTTTAATCTATAATAATATTATTCACATTAATATTT
AATAAATCCAATCAATTACTACCATCTTCTTTGACCAAACTATCCAAAAAACTTTTACGT
GTTCTTTCTTTAATTTCCTATTTACTTTTTTAATTTATGCTAATTACCTATTATGATATT
CAACAGGCAGGTATAATCCTATATGATGAATGGTTCTAAATTCAGAAAAAGATTTATGAA
TTACTAATTAAAGACTTTAATTAAATGAATGATCCCGAGTATATCAAAAAGAAAGAAGAA
GAGAAGAAAATTGAAATTTAAAAGTAAGCTTAGAAAAGAAAAAAGACATTTTAAAAATAA
ACCATCACCCTCACAAAGAAGCTAATTGAAATATAGCAAAAAATAAAGAAGGCAGAAGAA
GATGAATTAGAAGGAAAGCTTAAAAGTGAATAAGAAGAAAAGGATTAAGCCCAAGATAAA
ATGGATGTTGAAGGAGAAGAAGGCATTCAAGCAAGTGATAAAAAAGTAAGAAGACCTCGC
TTTAGCTTGATTGATGAAATGAAGCTTTTTTCTGCAGAACATTAAGAAGAAATAAGCAAT
AACTTAACTTTAAAAGACATTGATATGAAGGAAGAGCATGAAATTAAAAATGTTATCAAT
ATCTTCATTTAAGCTAATAAATTCTTGCTGGATGTAGAATTCTCAGATGATGAGGATGCT
AAATTAGAAAATGATGAAAATAAAATTAAATCAAGCTGTGTAGGAGATGAAAATGAAGAA
AACTAGCTCTCAGAAGAATAAAAAGCTGAAAAACGTAAAAAAATTCGTGAAGAAGCTGTA
GCAAAATATATCGATGCCATGTTCTAGTCAATAAAAAATCGCCGTAAAAAAGGATCAGTT
GTAGACTTGACTCTTGAAGAAATCGAGAAATACAATCCAGGTAAATATAATTATAATTGG
TTGGCAGATGAAGGACTTAATTCTGCAAGCGTTGAAGAGGAACTCTCTGTATATATTTCT
GCAGAAGAAGCTGATGCATTATCTCTTTCAGTTGAGATAGATACCTTATATCTTGTGAAA
TGGAAAAATTTATCTTATCTTGAAAGCACTTGGGAACACGAGAGCATTATCGCTAATCAG
ACTAAGATAAATGACTATCGTATGTATAATCGTGCCCTTGATAAGGAATCTCGTCAAGTT
TTAAGTTAATAACTTGAGCGCCACAAAACATTACTTGATCTAGAGTAAAACCCAAAGAAA
AAGTAGAAGATTGGTCCATAAGGACTTATTGAATTAAAAAATAAACTCTTTTTCTATGAT
GTTGCTAATTACAAATAGCCATTTTAATATACATAAAAGACACAACCTATCTATAAATAG
AGAAAACTCCTTCGTTATTATTAATTAGAGTCTCTCAACTGGATGATTGAAGCTTGGTAT
AGTAAAAGAAATGTTATTTTAGCTGATGAAATGGGTCTCGGTAAAACTATTTAATCCACT
GCTTTTATTAATCACCTTTACACTTTTGAAAATGTTCGTGGTCCTTTCCTAATTATAGCT
CCTCTGAGTACTTTAGAGCACTGGAAGCGTAGTGTAGAAGATTGGACAAATTTAAATGCT
GTTCTTTACTATGACCACTCTGGTTAGGAAGGCCGTAATTGTTGTAGATTCTACGAATGG
CTATATACTGATATCTCTACTAAAGGTACTGTATTATAATCAAATGAAATCTACAAATTC
TAAGTCTTAATCACTTCAAATGAAGTATTCTTGAGTGATACCAATAATTTCCTCATAAAT
ATTCCCTTTTAATTTATTGTTGTCGATGAAGCTCACAGACTTAAAAATCAAAATGCAAAA
ATTTTAGCAACATTAAAACGCTTACCTTGCAAGCGTACACTCCTTTTAACAGGTACTCCT
ATTTAAAATAACACAGAAGAACTATGGACTTTGCTTAATTACATTGAACCAAACAAATTT
GCAAGTCTTCAAGAATTCAAAGAATAGTTTGGTGAGTTACAAAACAAAGAATAAGTAGAT
AATTTGCAAGTAAAAATTAAACCATTTTTACTGAGACGTATGAAAGAAGATGTAGAAGAC
AGGTATGATTTTTCAATTATTATTCCTTATTAAAATTTTATTAAAAATTAATTCTCAAAA
AAATGAAAGAAAATAAAAAATTATTTGCTCATTTAAAATTTAAATAAAATTATTTCTAAC
ATTAATTTTTTATTAAGAAAAAAAATTAATTAGTGAATTTAAATTTATTAATTTTCTTAC
AAATAAATAATTCTCATTTTATAAAAAAAAGTATTCCTCCTCTTTAAGAAACAATTATAG
ATATTGAAATGACTACTCTCTAAAAAACTCTTTATCGTGCTATCTATGAAAGAAATAAAA
GTATGCTCCAAAAGAATTTTTCATCTATGGCTATGAATACTTCACTTAACAATTTAGAAA
TGCAACTCAGAAAATGTTGCAATCATCCTTTCTTAATTAAAGAAATGGAAATAGAACTCA
CCCAAAATTTTAAAACTTCTGAAGAGCGCTATAAATGCCTTGTTGATACTTCTGGTAAAA
TGATTTTACTTGATAAGCTCGTTCAGAAATACAAAATTGAAGGAAAGAAGATTTTGATTT
TCTCTTAATTCGTTTATATGCTAAACTTACTTGAAGAATATCTTCGTTATCGTTAACTTA
AGTATGAGAAAATTGACGGATCAGTTAAATCTAAAGAGCGTTAGAATGCTATTGATCGCT
TCAATGACCCTGATAAAAAGCGTGATGTTTTCTTACTTTCAACTAAAGCTGGTGGTCTTG
GTATTAACTTGACATCTGCAAATATTGTAATAATATTTGATTCAGATTGGAATCCTTAAA
ATGATGTCTAAGCTACTGCTCGTGCTCATCGTATTGGCCAAAAATAAGAAGTTATGGTCT
ATCGTTTTATCACAAAAAAAACTTACGAGGCTGAAATGTTTGAACGTGCTACTAAAAAGC
TAGGATTAGATTAGGCTATATTTATGGGTGGTGAGTTCAAATCAGTCTAAGGTAACAAGG
ATGAATCTAAGAAGCTTGGTAAAAATGATGTAGAAAGTCTTCTGAAAAAGGGTATTCTTG
GTTTGGTAAATGAAGAAGAAGAAAACAAAAAATCTAATGAATTTTAAGAAGAAGATATTG
ATATGATTTTAAAGAACAATACTCGTATTGCTAAGTATTCGGTCATAAATGGCAGCTATA
GTTTCAGCAAAGGTTCATTCATATCCAACAAGGCAGATACTGACCTCAAGATTGATGATC
CTAATTTTTGGAATAAAGTATTAAAAGACTAAGAAAGTAAGACTTTATTGGCTCTTAAAG
AATATGATGAGCGCTCTAAAATACTTTCTGTTGATGTTGAAGAATAAAAGAAATATTTCT
TTAAAGTTTGTGAATTTGTAAATGATCTTATTTCAAGTAAATTGAGCTTAATTGGCTACA
ATGCTGATGATGAAAAAAATATTACCGATATTTTAAATAAAATTTCTGATAGTAAAGACT
TCCATACTAAATATAAAGATCTTGCAATGAATTTTATTTATGAAGTCTCTCGCCCCTCTC
GTCGTTTCCGTAAAGTTACCTTGCAAGATTTGGATGTTACTAATCCAGAAAATCAGAAAT
CTAAAAAGAGTAAATAAATAATTTGAGCTAAAATTTTTTTTTAAAGAATATTAATTTTAC
ATTTATATTAGATATTTCCAATTCTTCTGACGAAAATGATCTCTTTTATGATGGATACTC
AGATTTAGAATCAGATGAATTAGGCGTTGGTTCTGTAAATAACTTCCCATCAGAAAAAAA
GACTGGAAGTAAAGACAAAGAAAAAAGTTCAGAAAATGGTGGCAGCGGAGTAAGTAAAAA
AGAAGACCTCTTCAAGAAATTATGCTATTATTGCGATCGCCCAAAATGCACTGTATTCTG
TTAAGGTCATTGTAAGAGATCATTCCATAGTGAATGTAAAGAGAGAGTAGAAGCAGGATG
GATTAATGAAAATGGTATGACAAGCGAAACTAGAATCGTACCTACTGAGGATCATTACGA
TGAAGAACGTCTTAAAAAAATGTTAAATATTAACTATACATGCAAGGATTGTGAAGCAAA
TACAGCTATCTGCTTTATTTGCAAAAAAAAAGGAAGTTTCTTCCCTCCTGCCGTTTTAAA
TAAATAAAATAAGCGTATTTAATAATAAAAATAAAAAATTATTGCAGAGAAAGAAAAGCA
AAAGGACCCATCTAATGAAATAGTTGAGGAATCTGAGAATGAATTAGATGAAGATTATGA
CTTGGTTGAAGATGATTCAGTATCATAAAAAACAAGTGATTTGACAAAATGCTCAACTGC
TAATTGTAATAAATTTTACCATCCTGTTTGTATTAAGCCTTATGCCTTATTCAAGTACAT
TGATTCAAATAATAAACGTTTCCGTTGCCCATTACATTATTGTGCTCATTGCTTTATTTC
TGGAGATTCTATGGCTATTTCTTAATGTGTTAGATGTCCTAAAGCCTATCATCTTCGCTG
CTTTGAAAAAGCTAAGGTCCTGAAACTTACAAAAAAACTTATGCTTTGTGAAGATCACCC
TCATTAATATTATAAAAACATACATTCTAGCAGCGGATCTAATTCAAATAATAAAAATAG
CTCATCATAATCAAATAACAACAACAATAATAATAATAGCAGATAGTAGAGTTCATAAAA
TGTATCTGCTAGTAACACTAATACTAGATCCAAATCTGGTGCAACAAATAGCAACGATAA
CATTGTTGATGATACTTAACAAAAGAAATAAAAATTAAATAATGGTACAGGATAAGTAAG
CACAAATAATAAAACTTCTTCAAATAATTCATCCTAATAAAATGGTGTTAATTAAGCAAA
GGAAGCTCTGGAAAAAGCCACTTAACCAGCAGCAAATTCTAATCAATCTTAAGCAAATAC
TTCTGGAAGAGAAGGTAGAATGACTCGTTCTCAAGAAAAAAATATTCAAAATTAACAATC
CACAATTAGTTAATTCTTTGGAAAAAAAGACAATAAACTTAAAGAAAAGTAAGACTAAAA
AAATGTAAAATTAGAAGATTAAATAAATTAAGAAGGAGATGACTTAAATAACAGTCAAAA
TAATGGAAACTTAGAAAACGGAGAATAAGAATAGACTGTTGCTCCTAAACCTAAAGCTAA
AAAGCCTGCTCCTCCCCCTCCACCACCACCAAAAGAGCGTGAACCTCCTTAATTTTCATA
TGAAGACTTTAAGATCCCATCACAAAAAGACTTTGACTACCAGAAATATCAAAGGGTAAT
TGAAAATTAATGATTTGATAAAAATAACCGAGAAAAAAATTTTATTTTATTTACAAAAAA
CTAAAATATAAAAATTATAATGTTAAGAAAAAAGATTTAGAAAAAAATTAAAATAATTTT
TAACCCACCTTACTTTTAAAATAATAAAAGCTAAGATAAAAATTATCAATTTATTTTAAA
AATTTAATTAATTAATTTTTTTAAATTAGGATTGGTGCAGATATTGTGGTGCAAGATTCT
CAAGCAATTTCACAAAAGGACCATGGGGACCTAGAACACTCTGCACAGTTCATTATATAG
CATGGAATCAAAAGAAGAAGTTGGATTTAAGGGCTTATAAAGAACTACCTACTAAACCTA
TAAATCCTGATGACTAAACTGAGCTACATTTTATGAGTAGACTAAAATAAAAGGATGAGT
CTTACAATCCAGAGATTCTTTTGAAGGAGATGATGAATATTAATCTTAATGGCCTCTCAT
CTTTGAATAGCTAAGAATTGAAAGATGTAAATTAGGATAGTAACTCTGGTAAAGCTTCAA
GTTCAGAAAAATAGGAATCAAAAAAAGAAACACCTGCCTCTAACACAAATAAAAATGAAA
CAAAGACAGAGGAAGAAGATGGCTAAAAAATAAACAAGGTTTGA