Identifiers and Description

Gene Model Identifier

TTHERM_00275740

Standard Name

CHC1 (Clathrin Heavy Chain-like protein)

Aliases

PreTt09915 | 24.m00346 | 3690.m00155

Description

Region in Clathrin and VPS family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18%

TetraMine Data

TTHERM_00275740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_105390
WormBaseWBGene000118679.997093137033517e-262locus:chc-1 Probable clathri
n heavy chain 1 status:Parti
ally_confirmed UniProt:P3457
4 protein_id:CAA83003.1
Tetrahymena borealisEI9_06823.19.997093137033517e-262region in Clathrin and VPS fam
ily protein (1738 aa)
DictyBaseDDB_G02772219.997093137033517e-262chcA on chromosome: 2 position
7717198 to 7722630
OxytrichaContig18542.0.g949.997093137033517e-262Region in Clathrin and VPS
SGDYGL206C9.997093137033517e-262CHC1 Clathrin heavy chain, sub
unit of the major coat protein
involved in intracellular pro
tein transport and endocytosis
; two heavy chains form the cl
athrin triskelion structural c
omponent; the light chain (CLC
1) is thought to regulate func
tion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_00275740(coding)
ATGCAAGGAGGCGTTCCTATTAGAGTTTAGACAGTTGCTTCCCTAACCCAATTAGGAGTT
GGTTCTGAATATCTTAAGTTCAATTAAACAAGCTTTTAGTCAGATAGAACTATTTGCATT
AATGACAAGAATGCACAAGGATAAAACCAATTGACATAGATTTAGGTTGACAACAACTTC
AGCGTTAATAGAAAACCCAATAAAGCTGAGTACAGTTTAAACCATCCTACAAAGAATATC
CTTAGTATGAGAGCTCCTAGTCCCAACGGAGTAGGCTGTTATGTTTAAATCTATAACTTA
GACAACAGAGAAAAGCTAAAACATATTGATTTAAATGAAAACATTGTCTATATGACTTGG
GTTAACAATAACATATTAGCAATGGTTACTCCCACCAAGGTTTATCATAGTGATCTTACT
TCCCAAGCTCCTTCAACAGTTGCTTTTGAAAGAGCTGGTAATTTAGCTAACCCCAACTGT
TAGATTATTGGTTATAAAGTTAACACCTAAGGTAATTGGGCTGCCTTATACGGTATCTCT
TCTCCTGATTAGAGACAAATTAATGGTGATATTCAATTATATAAGCTTGATGAAAACAGT
TAATAACCTTTAACTGGTCACTGCTGTTGCTTCGGATAGGCTAAAATTCATAATGATACT
CACCTTTCAGATATTTTTGCTTATTATGATAGAAAACCTGGTGACACTGTTGCTAAAATT
CTTTTAAGAGAATTATCAGCTCCTCCTGAGGGTTTCTAAAAATATAAGGGAGCTGCTGAA
TATCCTTTCAATGCCTAATTCCCAGCTGATTTCCCTATTTATATGTAAGTTTGCACTAAA
TATGGTTAACTTTTCTGCTTGAGCAAGAGCGGTTTCCTCTTTGTTTATGAATTGACTACC
AGCGCCCTTATCTATCAATAAAAGGTTACTGATTCTTCTATCTTTGTTGCCACTCAAGAC
TCTAAAGAAGATGGTATCTATGCTATTGCTAAAAACGGTAATGTAATTCTTATATAAATT
GACCCTTCTTAACTAGTTCCTCACCTCTAAAGATAATAAAATATTCCTAATGTCGTCTAA
GTTGCCTTCAAGCTTGCTTCTAGATATAGACTCCCTGGAGCTGATGGTATGTTCATGGAT
TAATTCAATAGATTTATGATGGCAGGTGATTACGCTAACGCTGCTTAAATTGCTGCTGGC
GCTCCTGGTGAATTAATTAGAAATGCTTAAACTATTGCTAAATTTAAATAACTTTAAGGC
ACTCCCTCCCCTCTTCTTGTTTATTTCTAAACTTTAATCTAAAAGGGTACCTTAAACTAA
TTAGAATCTTACGAACTTGCTCAATTCCTCTTGAGCTAGAACAAAATGACTGCAGTTGAA
AAGTTAATGAATGAAAATAAGCTTGAATACTCTGAAGGTTTGGGTGATTTGATTGCCACC
TAAAATCCTAACTCAGCTCTTGAAGTTTACAAGAAATCTGGTTCTCACTTAAAGGTTATT
TCTACCTTAGGAGGTTTGGGTCGTATTGATGAGGCTGATAAGTACGCTCGCTTAAATAAC
TTAAGCTAAATTAACTACACTGAAGTTATTAGATCCACTGTCCTCACCAACCCCTAATAA
GCAGTTACCCTTGCCAAGACTTAAGTTGCCACTAATCCCAGCACTAATGTTCATCAAATT
GCTGAAATCTTTGGTTAAGCTGGTAAGTTCAAGGAAATGAGTGCATTCCTTGTTGACTGT
ATGAAGTAAAACAGACCTGAAGATGGTCCTTGGTAAACTAAGGTCCTTGAATGGAATATC
ATAAATGAACCTAACATTGTTGACCCCATTTTCGATTTAACCAAATGGAATCAATACAAC
AGATTACGTATTGCTTAACTATGTGAATAAAAGCAACTCTACTAGAGAGCCCTTGAAAAT
TACTCTGACATCAAGGACATCAGACGTGTCTGCCTTAACACTCATATGATTCAACCTGCT
TGGCTCGTTAATTATTTCAGTAATGTCCAAACTGATTGGGCTCTTGCTTGCATGTAAGAT
TTATTGAAACATAACAGATAAAATCTCCCATTAGTTGTTGAAGCTTGTGCCAAGAACTAT
TAAAAATTCACTGTTTAAAGCTGTATCAAGTGCTTCGAATCTGTTGGTTCATTCGATGGT
GTCTATACCTTCTTAAGTTAAATTATTAACTCTACTGAAGACAAGGATATCCATTTCAAG
TATATTGAAGCCGCCACCAAGTGCAACTAATTGAGAATTGTTGAATAAGTTATTTAGGAA
AAGGCTAACTGTTATGATCCCGTTAAGGTTAAGGATTTCTTAAAAGGCTTACGTTTACAA
GATCCTAAGCCTCTTATCTTCCTTTGTGATATTCATAAATATATTGATGAATTAACTGCT
TATCTTTACCAAAACAATTTCTTGAACTACATTCAAATTTACTTGTTCTAAGTCAATCCT
CAAGCTGCCCCCATTGTCTTGGGAACTTTGATTGATCAAGAATGTGAAGAAAGATAAATT
CAAATCATTTTACAACAAATTGCTGGTAAATTGATTCCTTAATGCTACGAACCCTTAATT
GAAGAATTCGAAAAGAGAAACAAACTCAGAGTTCTTGAAAGCTGGCTTGAAGGAAGATGC
AACGAAGGAAACTAAATTCCTGCTATCCATAACGCTTTAGCTAAAATTAAGATTGATACC
AACTAGGACCCTGAAACTTTCTTACAAAACAACCAATTCTATGATGCTAAGGTTGTTGGT
AAGTTCTGTGAAGAAAGAGATCCTCACTTAGCTGTTATTGCTTACAAGAGATCTTGGGGT
CAATGCGATGAAGAATTAATTATGGTCACTAACAAGAACGCTCTCTTCAGACTTTAAGCT
AGATATTTGGTTGAAAGACAATCCAAGGAATTGTGGGCTAGCGTTTTAACTCCTGACAAT
CCTTACAGAAAGTAAGTCATTGAATAGGTTGTTTAAAGTGCTCTTCCCGAAAGCAAGGAT
GTTGACTAAGTTTCTACTGCTGTCAAGGCCTTCATGGATGCTGAACTTCCTGAACATTTA
ATTACCTTATTGGAAAAGATTGTCCTTCACAACCACGAATTCGGTCAATACAAGAAGCTC
CAAAACTTATTGATCATCACTGCTATTAAGAGTGACAAGACCAAGGTTATGGATTACATT
AACCGTCTTGATAACTATGATGGACCCGAAATTGCTAAGATTGCTTTGGGAGATCCTTAC
TAACTCTATGAAGAAGCTTATATTATTTATGTTAAGTTCAATCAACCTGTCTCTGCCATT
GAAGTCCTTATTAACAATATTGATGACATCCCTAGAGCTGCTGAATATGCTCAAAAGGTT
AACAACCCTGAAGTATGGAGCAAAATTGCTAATGCCTATCTTGACCGTTCCCAAATCACT
GAAGCTATTGATTCCTACATTAAGGCTAAGGACCACACTATGTACCTCCAAGTCATCAGT
GCTGCCGAAATCGATGGTAAGTTCGATCAACTCATTAAGTATCTCTTGATGGCCCGTGAA
AACATTAAGGATGCTTAAATCGATAACGCTCTCGTCTTTGCCTACGCTAAGACTGAAAAG
ATTACTGATCTTGAAAACTTCATTTCTAATTCCAATTCTGTAGATTACCAACGTGTTGGT
GATCGTTGTTACGATGAAAAGCACTATGAAGCTGCAAAATTGCTCTTCACTGCTACTAAG
AATAATGCCAAGATTGCATCCTGTCTCGTTAGATTAAAACAATTCTAACAAGCTATTGAT
GCTGCTAAGAAAGCTAATACCCCCAAGACCTGGAAGGAATTAACTATGGCCTGTGTTGAA
GCTGCTGAATTTAAACTTGCTGCTGTTGCAGGTCTCAACATTATCATTCATCCTGACCAT
CTTGAAGAATTAGCTTAATACTATGAAGAATTTGGCTACTCAAATGAAATGATCTCTTTA
CTTGAAACTGGTATGGGTCTTGATCGTGCCCACGTCGGTATCTTCACCGAATTAGGTGTC
CTTCTTGCCAAGTACAGACCTGAAAGACTTATGGAACACTGCAAGCAATACTACTCTAAA
ATGAACATCTCCAAATTACTTAGAGTTTGCGAAAGATACTAACACTGGTCTGAAGCTGTC
TTCTTGCACTCTAACTATGATTAATATGATAACGCTATCAACATTATGATTGAACACTCA
CCTGTTGCTTTTAATCATGATCAATTCGTTAATCTTTTAATTAAGGCTTCAAATTACGAT
TTATACTATAAAGCTATTCTCTTCTATTTAGACGAACAACCTGAATAAGTCAACGAACTT
CTTAGATCTCTCACCACTAAGATTGACTTGAGCAAATGTGTCTCTGTCATGAGAAAGACT
GGTTATATTGCTTTGATTACCCCCTTCTTAAAATCCGTATAAAATGCTAATAACAAGGAA
GTTAATGAAATCTTGAATGAAATCTACTTAGAAAGCTTCGATTACGAAAATCTCCGTCAA
TCCATTACAACATATGAAAACTTCGATCAACTCACTTTGGCTTAAAATTGTGAACGTCAC
ACTTTATTAGAATTCAGAAGAATTTCTGCTTATCTTTACAGACGTATTCAAAAGTACGAA
TTCTCTATTGCTCTCTCTAAGCAAGATAACATTTACAGAGATGCCATCGAAACTGCTTAA
GAATCTGGTAAGGTTGAATTAGTAGAAGATCTCCTTAAATTCTTTGTCTAAAAGGGTGAA
AAGGAATTCATTACTGTTACTTTATATACTTGCTATGAATTAATCAGACCTGATTTGGCT
ATGGAATATGCTTGGAGATTTAACTTATTTGAATTTATTATGCCTTACTTCATCTAAATT
ACTAAAGAACTTACTTCTAGAGTTGATACAGTATAAAAGAAGCACGAAAAACGTGAAAAA
GAAGAAGAAAAGAAAGCTAATTAATAATTAAACTAAGGTATGTTCATGCCTACACATGAT
ATTTTACCAACTGCACTTATGATTGGACCTCCTCCCGGTTCTATGCCTGGTATGAATATG
CCTCCTATGGGTGGTATGCCCCCTATGGGTGGTATGCCTCCAATGGGCGGAATACCTCCA
ATGGGTGGAATGCCTCCAATGGGTGGTATGCCTCCTATGGGTGGTATGGGTGGTTTCGGT
ACAAACCCCTTCGGTCCTTAATGA


>TTHERM_00275740(protein)
MQGGVPIRVQTVASLTQLGVGSEYLKFNQTSFQSDRTICINDKNAQGQNQLTQIQVDNNF
SVNRKPNKAEYSLNHPTKNILSMRAPSPNGVGCYVQIYNLDNREKLKHIDLNENIVYMTW
VNNNILAMVTPTKVYHSDLTSQAPSTVAFERAGNLANPNCQIIGYKVNTQGNWAALYGIS
SPDQRQINGDIQLYKLDENSQQPLTGHCCCFGQAKIHNDTHLSDIFAYYDRKPGDTVAKI
LLRELSAPPEGFQKYKGAAEYPFNAQFPADFPIYMQVCTKYGQLFCLSKSGFLFVYELTT
SALIYQQKVTDSSIFVATQDSKEDGIYAIAKNGNVILIQIDPSQLVPHLQRQQNIPNVVQ
VAFKLASRYRLPGADGMFMDQFNRFMMAGDYANAAQIAAGAPGELIRNAQTIAKFKQLQG
TPSPLLVYFQTLIQKGTLNQLESYELAQFLLSQNKMTAVEKLMNENKLEYSEGLGDLIAT
QNPNSALEVYKKSGSHLKVISTLGGLGRIDEADKYARLNNLSQINYTEVIRSTVLTNPQQ
AVTLAKTQVATNPSTNVHQIAEIFGQAGKFKEMSAFLVDCMKQNRPEDGPWQTKVLEWNI
INEPNIVDPIFDLTKWNQYNRLRIAQLCEQKQLYQRALENYSDIKDIRRVCLNTHMIQPA
WLVNYFSNVQTDWALACMQDLLKHNRQNLPLVVEACAKNYQKFTVQSCIKCFESVGSFDG
VYTFLSQIINSTEDKDIHFKYIEAATKCNQLRIVEQVIQEKANCYDPVKVKDFLKGLRLQ
DPKPLIFLCDIHKYIDELTAYLYQNNFLNYIQIYLFQVNPQAAPIVLGTLIDQECEERQI
QIILQQIAGKLIPQCYEPLIEEFEKRNKLRVLESWLEGRCNEGNQIPAIHNALAKIKIDT
NQDPETFLQNNQFYDAKVVGKFCEERDPHLAVIAYKRSWGQCDEELIMVTNKNALFRLQA
RYLVERQSKELWASVLTPDNPYRKQVIEQVVQSALPESKDVDQVSTAVKAFMDAELPEHL
ITLLEKIVLHNHEFGQYKKLQNLLIITAIKSDKTKVMDYINRLDNYDGPEIAKIALGDPY
QLYEEAYIIYVKFNQPVSAIEVLINNIDDIPRAAEYAQKVNNPEVWSKIANAYLDRSQIT
EAIDSYIKAKDHTMYLQVISAAEIDGKFDQLIKYLLMARENIKDAQIDNALVFAYAKTEK
ITDLENFISNSNSVDYQRVGDRCYDEKHYEAAKLLFTATKNNAKIASCLVRLKQFQQAID
AAKKANTPKTWKELTMACVEAAEFKLAAVAGLNIIIHPDHLEELAQYYEEFGYSNEMISL
LETGMGLDRAHVGIFTELGVLLAKYRPERLMEHCKQYYSKMNISKLLRVCERYQHWSEAV
FLHSNYDQYDNAINIMIEHSPVAFNHDQFVNLLIKASNYDLYYKAILFYLDEQPEQVNEL
LRSLTTKIDLSKCVSVMRKTGYIALITPFLKSVQNANNKEVNEILNEIYLESFDYENLRQ
SITTYENFDQLTLAQNCERHTLLEFRRISAYLYRRIQKYEFSIALSKQDNIYRDAIETAQ
ESGKVELVEDLLKFFVQKGEKEFITVTLYTCYELIRPDLAMEYAWRFNLFEFIMPYFIQI
TKELTSRVDTVQKKHEKREKEEEKKANQQLNQGMFMPTHDILPTALMIGPPPGSMPGMNM
PPMGGMPPMGGMPPMGGIPPMGGMPPMGGMPPMGGMGGFGTNPFGPQ


>TTHERM_00275740(gene)
TAAAAAATAATTAAATAAAAAATCTTTAAAATAAAAAAGAAATAAAGAAGAAGAAAACAA
AATCAACAACAAAAAACAAAAGACATGCAAGGAGGCGTTCCTATTAGAGTTTAGACAGTT
GCTTCCCTAACCCAATTAGGAGTTGGTTCTGAATATCTTAAGTTCAATTAAACAAGCTTT
TAGTCAGATAGAACTATTTGCATTAATGACAAGAATGCAGTAAAATTATGATTCATTCTG
CTTTGAGATTTTAACATTTTTCTCAGTCTTCAAAATCCTCTTATTAGATATATTGATTCC
TCAAACATAACTATTATTTCAATTTTAGTTGGCATGATTACTTTTTAAATTTTTACATTT
TTTAAATTTTTGGTTAATCCAAATCAATTATGAAGCATTTAAAGGAGTAAGAGCCTTACC
ATAAACCAGTTGAGCTTTAAGCTTAGCCCAAAAATTAAAGAATTATTTTGTAAATAGTAA
GATACGCAGTAGCTGATCCATTTATTTTTATCTTAAAACTAACAAATTTTTCTTTTTGTA
ATTTTGAATGAATAGAAGAGGAAAAAGAAAGACTTTTAAATAGTTCAATATGAATATTAA
ACAAAGCTAAAGATATTTTTTTTAATAATAAACATTAGCAAGGATAAAACCAATTGACAT
AGATTTAGGTTGACAACAACTTCAGCGTTAATAGAAAACCCAATAAAGCTGAGTACAGTT
TAAACCATCCTACAAAGAATATCCTTAGTATGAGAGCTCCTAGTCCCAACGGAGTAGGCT
GTTATGTTTAAGTAACCTAATTTATTCTTATTATATTTTGATATTTGCACAAGCCCTTAG
CTTGATTACTGCTTTTACCACAGAGAGGTGAAAAATTCTAAATATTTTCATCTTTTCTGC
TAAAATAATCTCTTTTTTTTCCATGTTTTCAAACTCTTATTAACGGTGTTTAATAAAATA
TAAAGATCTATAACTTAGACAACAGAGAAAAGCTAAAACATATTGATTTAAATGAAAACA
TTGTCTATATGACTTGGGTTAACAATAACATATTAGCAATGGTTACTCCCACCAAGGTTT
ATCATAGTGATCTTACTTCCCAAGCTCCTTCAACAGTTGCTTTTGAAAGGTAACATATAT
TTAAAATAGAATTTTAAAATAAATAAGCTGAAAGATCAATCTATCGCTCAATCCCAGCAC
TAAAACAATAATATTTTATAGAAATGCAAATCCAAAATACATAGAGAAAATTAAAGAATA
AATAATGCAAATAATATTGCTGGACAACTTGAATTTTTCATCAGTTTAAGCAATTAAATG
TTATTGAAATAATGAGAGAGAAGCAAAGAAAGAAAAATAGATGTGATTGCACTTAATATA
ACTCAATAATTTATTATTTTTGAAAATGAAATCAAATTAAATGAAAACGAAAACAATGAT
TAAATAAACTAACAAATAAACAAATTAATAAATAAATAAAACAAAGAAAAAAAGAAAGGT
TGATAGAAAAAAAATAAATAAATATCCTATTTTATTATTTATTTATTATATTAATTTTAT
TTAATTAATTAATTTCTTTTTTTAATTTTATTTGCAACTCACATTTTATTTTTTCTGATT
ACTTTTTTTTGCTATTCTTTTGAGATATCTTAATCTTAACTAATAAATAAATAAATCAAT
AAACAAAGAAAGAAAGAAATAAAAAAACAATGCCATCCTTATTTCTCTCAAATAAAATAC
TTAATGCATTTTCTTGATAAATATACCAATTTATTTAAATTTCAAAAATTTTATTCGCTT
AATTAACCATTTAATAAACTTACTTATCAGAAATTTGACAAAAATAATTATTCTTTAAAT
AAGTATTTTCAAATTAATTTAAATATTTTTTTCCATAAAATAAATAATAGAGCTGGTAAT
TTAGCTAACCCCAACTGTTAGATTATTGGTTATAAAGTTAACACCTAAGGTAATTGGGCT
GCCTTATACGGTATCTCTTCTCCTGATTAGAGACAAATTAATGGTGATATTCAATTATAT
AAGCTTGATGAAAACAGTTAATAACCTTTAACTGGTCACTGCTGTTGCTTCGGATAGGCT
AAAATTCATAATGATACTCACCTTTCAGATATTTTTGCTTATTATGATAGAAAACCTGGT
GACACTGTTGCTAAAATTCTTTTAAGAGAATTATCAGCTCCTCCTGAGGGTTTCTAAAAA
TATAAGGGAGCTGCTGAATATCCTTTCAATGCCTAATTCCCAGCTGATTTCCCTATTTAT
ATGTAAGTTTGCACTAAATATGGTTAACTTTTCTGCTTGAGCAAGAGCGGTTTCCTCTTT
GTTTATGAATTGACTACCAGCGCCCTTATCTATCAATAAAAGGTTACTGATTCTTCTATC
TTTGTTGCCACTCAAGACTCTAAAGAAGATGGTATCTATGCTATTGCTAAAAACGGTAAT
GTAATTCTTATATAAATTGACCCTTCTTAACTAGTTCCTCACCTCTAAAGATAATAAAAT
ATTCCTAATGTCGTCTAAGTTGCCTTCAAGCTTGCTTCTAGGTATAATACTCTTTGCAAT
TACAATTTAATTGAATTTAAAAAAAATAATACTTAAATTATTGAATTAAATTTTTTCCAA
TTAAAAAAATTAGATATAGACTCCCTGGAGCTGATGGTATGTTCATGGATTAATTCAATA
GATTTATGATGGCAGGTGATTACGCTAACGCTGCTTAAATTGCTGCTGGCGCTCCTGGTG
AATTAATTAGAAATGCTTAAACTATTGCTAAATTTAAATAACTTTAAGGCACTCCCTCCC
CTCTTCTTGTTTATTTCTAAACTTTAATCTAAAAGGGTACCTTAAACTAATTAGAATCTT
ACGAACTTGCTCAATTCCTCTTGAGCTAGAACAAAATGACTGCAGTTGAAAAGTTAATGA
ATGAAAATAAGCTTGAATACTCTGAAGGTTTGGGTGATTTGATTGCCACCTAAAATCCTA
ACTCAGCTCTTGAAGTTTACAAGAAATCTGGTTCTCACTTAAAGGTTATTTCTACCTTAG
GAGGTTTGGGTCGTATTGATGAGGCTGATAAGTACGCTCGCTTAAATAACTTAAGCTAAA
TTAACTACACTGAAGTTATTAGATCCACTGTCCTCACCAACCCCTAATAAGCAGTTACCC
TTGCCAAGACTTAAGTTGCCACTAATCCCAGCACTAATGTTCATCAAATTGCTGAAATCT
TTGGTTAAGCTGGTAAGTTCAAGGAAATGAGTGCATTCCTTGTTGACTGTATGAAGTAAA
ACAGACCTGAAGATGGTCCTTGGTAAACTAAGGTCCTTGAATGGAATATCATAAATGAAC
CTAACATTGTTGACCCCATTTTCGATTTAACCAAATGGAATCAATACAACAGATTACGTA
TTGCTTAACTATGTGAATAAAAGCAACTCTACTAGAGAGCCCTTGAAAATTACTCTGACA
TCAAGGACATCAGACGTGTCTGCCTTAACACTCATATGATTCAACCTGCTTGGCTCGTTA
ATTATTTCAGTAATGTCCAAACTGATTGGGCTCTTGCTTGCATGTAAGATTTATTGAAAC
ATAACAGATAAAATCTCCCATTAGTTGTTGAAGCTTGTGCCAAGAACTATTAAAAATTCA
CTGTTTAAAGCTGTATCAAGTGCTTCGAATCTGTAAGAAATTTTTAATTCCCTAACATTT
TTAAAATTTAAATTTCTTTATAATAAGGTTGGTTCATTCGATGGTGTCTATACCTTCTTA
AGTTAAATTATTAACTCTACTGAAGACAAGGATATCCATTTCAAGTATATTGAAGCCGCC
ACCAAGTGCAACTAATTGAGAATTGTTGAATAAGTTATTTAGGAAAAGGCTAACTGTTAT
GATCCCGTTAAGGTTAAGGATTTCTTAAAAGGCTTACGTTTACAAGATCCTAAGCCTCTT
ATCTTCCTTTGTGATATTCATAAATATATTGATGAATTAACTGCTTATCTTTACCAAAAC
AGTAAATTTAATTTGAATATTTGGGACTTAACAATATTAAAATTTTTTGTTATTAATTAG
ATTTCTTGAACTACATTCAAATTTACTTGTTCTAAGTCAATCCTCAAGCTGCCCCCATTG
TCTTGGGAACTTTGATTGATCAAGAATGTGAAGAAAGATAAATTCAAATCATTTTACAAC
AAATTGCTGGTAAATTGATTCCTTAATGCTACGAACCCTTAATTGAAGAATTCGAAAAGA
GAAACAAACTCAGAGTTCTTGAAAGCTGGCTTGAAGGAAGATGCAACGAAGGAAACTAAA
TTCCTGCTATCCATAACGCTTTAGCTAAAATTAAGATTGATACCAACTAGGACCCTGAAA
CTTTCTTACAAAACAACCAATTCTATGATGCTAAGGGTAAATTATCATTATTTTTCAAAT
AAAAGTAAGAAACATTTCTAAAAATTTCTAATTAATATAAATAGTTGTTGGTAAGTTCTG
TGAAGAAAGAGATCCTCACTTAGCTGTTATTGCTTACAAGAGATCTTGGGGTCAATGCGA
TGAAGAATTAATTATGGTCACTAACAAGAACGCTCTCTTCAGACTTTAAGCTAGATATTT
GGTTGAAAGACAATCCAAGGAATTGTGGGCTAGCGTTTTAACTCCTGACAATCCTTACAG
AAAGTAAGTCATTGAATAGGTTGTTTAAAGTGCTCTTCCCGAAAGCAAGGATGTTGACTA
AGTTTCTACTGCTGTCAAGGCCTTCATGGATGCTGAACTTCCTGAACATTTAATTACCTT
ATTGGAAAAGATTGTCCTTCACAACCACGAATTCGGTCAATACAAGAAGCTCCAAAACTT
ATTGATCATCACTGCTATTAAGAGTGACAAGACCAAGGTTATGGATTACATTAACCGTCT
TGATAACTATGATGGACCCGAAATTGCTAAGATTGCTTTGGGAGATCCTTACTAACTCTA
TGAAGAAGCTTATATTATTTATGTTAAGTTCAATCAACCTGTCTCTGCCATTGAAGTCCT
TATTAACAATATTGATGACATCCCTAGAGCTGCTGAATATGCTCAAAAGGTTAACAACCC
TGAAGTATGGAGCAAAATTGCTAATGCCTATCTTGACCGTTCCCAAATCACTGAAGCTAT
TGATTCCTACATTAAGGCTAAGGACCACACTATGTACCTCCAAGTCATCAGTGCTGCCGA
AATCGATGGTAAGTTCGATCAACTCATTAAGTATCTCTTGATGGCCCGTGAAAACATTAA
GGATGCTTAAATCGATAACGCTCTCGTCTTTGCCTACGCTAAGACTGAAAAGATTACTGA
TCTTGAAAACTTCATTTCTAATTCCAATTCTGTAGATTACCAACGTGTTGGTGATCGTTG
TTACGATGAAAAGCACTATGAAGCTGCAAAATTGCTCTTCACTGCTACTAAGAATAATGC
CAAGATTGCATCCTGTCTCGTTAGATTAAAACAATTCTAACAAGCTATTGATGCTGCTAA
GAAAGCTAATACCCCCAAGACCTGGAAGGAATTAACTATGGCCTGTGTTGAAGCTGCTGA
ATTTAAACTTGCTGCTGTTGCAGGTCTCAACATTATCATTCATCCTGACCATCTTGAAGA
ATTAGCTTAATACTATGAAGAATTTGGCTACTCAAATGAAATGATCTCTTTACTTGAAAC
TGGTATGGGTCTTGATCGTGCCCACGTCGGTATCTTCACCGAATTAGGTGTCCTTCTTGC
CAAGTACAGACCTGAAAGACTTATGGAACACTGCAAGCAATACTACTCTGTATGATTTTT
TAAATATTTTGAAAGACAAAATTTATAATCTTCATTTATTAAATATTTTTATTAATCTAA
AATAGAAAATGAACATCTCCAAATTACTTAGAGTTTGCGAAAGATACTAACACTGGTCTG
AAGCTGTCTTCTTGCACTCTAACTATGATTAATATGATAACGCTATCAACATTATGATTG
AACACTCACCTGTTGCTTTTAATCATGATCAATTCGTTAATCTTTTAATTAAGGCTTCAA
ATTACGATTTATACTATAAAGCTATTCTCTTCTATTTAGACGAACAACCTGAATAAGTCA
ACGAACTTCTTAGATCTCTCACCACTAAGATTGACTTGAGCAAATGTGTCTCTGTCGTAA
GAAAATTTTATCAAAAAATAAAACAATTTAATTAAATTAATTAACATATAAAAATTAGAT
GAGAAAGACTGGTTATATTGCTTTGATTACCCCCTTCTTAAAATCCGTATAAAATGCTAA
TAACAAGGAAGTTAATGAAATCTTGAATGAAATCTACTTAGAAAGCTTCGATTACGAAAA
TCTCCGTCAATCCATTACAACATATGAAAACTTCGATCAACTCACTTTGGCTTAAAATTG
TGAACGTCACACTTTATTAGAATTCAGAAGAATTTCTGCTTATCTTTACAGACGTATTCA
AAAGTACGAATTCTCTATTGCTCTCTCTAAGCAAGATAACATTTACAGAGTATTTAATTT
TTATTTTAAATTTAAATATGGAATTAATTGATTCTTTTTTATTCTAAAAAATTAATTAAT
TAATTATCAAAAAAAGGATGCCATCGAAACTGCTTAAGAATCTGGTAAGGTTGAATTAGT
AGAAGATCTCCTTAAATTCTTTGTCTAAAAGGGTGAAAAGGAATTCATTACTGTTACTTT
ATATACTTGCTATGAATTAATCAGACCTGATTTGGCTATGGAATATGCTTGGAGATTTAA
CTTATTTGAATTTATTATGCCTTACTTCATCTAAATTACTAAAGAACTTACTTCTAGAGT
TGATACAGTATAAAAGAAGCACGAAAAACGTGAAAAAGAAGAAGAAAAGAAAGCTAATTA
ATAATTAAACTAAGGTATGTTCATGCCTACACATGATATTTTACCAACTGCACTTATGAT
TGGACCTCCTCCCGGTTCTATGCCTGGTATGAATATGCCTCCTATGGGTGGTATGCCCCC
TATGGGTGGTATGCCTCCAATGGGCGGAATACCTCCAATGGGTGGAATGCCTCCAATGGG
TGGTATGCCTCCTATGGGTGGTATGGGTGGTTTCGGTACAAACCCCTTCGGTCCTTAATG
A