Identifiers and Description

Gene Model Identifier

TTHERM_00283330

Standard Name

CET1

Aliases

PreTt04872 | 25.m00336 | p138 | 3694.m00119 | Spt16

Description

Protein associated with macronulear microtubules; sequence similarity to human transcription elongation factor FACT 140 kDa subunit, yeast Spt16/Cdc68, and Xenopus DUF140

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02016 ) LD-carboxypeptidase
  • ( PF00557 ) peptidase, M24 family
  • ( PF08512 ) Histone chaperone Rttp106-like
  • ( PF08644 ) FACT complex subunit (SPT16/CDC68)
  • ( TIGR02993 ) ectoine utilization protein EutD
  • ( PF01402 ) Ribbon-helix-helix protein, copG family
  • ( PF07334 ) Interferon-induced 35 kDa protein (IFP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00283330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08971.19.997093137033517e-262metallopeptidase family M24 co
ntaining protein (1010 aa)
WormBaseWBGene000188495.001363273675253e-167FACT complex subunit spt-16
status:Confirmed UniProt:Q9N
5R9 protein_id:CCD66831.1
DictyBaseDDB_G02826774.998437866964194e-166spt16 on chromosome: 3 positio
n 6105920 to 6109250
OxytrichaContig22561.0.g346.999646166012048e-157FACT complex subunit (SPT16/CD
C68)
SGDYGL207W1.0002534232488231e-144SPT16 Subunit of the heterodim
eric FACT complex (Spt16p-Pob3
p), which associates with chro
matin via interaction with Nhp
6Ap and Nhp6Bp, and reorganize
s nucleosomes to facilitate ac
cess to DNA by RNA and DNA pol
ymerases
Stentor CoeruleusSteCoe_186823.257488532207521e-70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15013445: Fujiu K, Numata O (2004) Identification and molecular cloning of Tetrahymena 138-kDa protein, a transcription elongation factor homologue that interacts with microtubules in vitro. Biochemical and biophysical research communications 315(1):196-203

Sequences

>TTHERM_00283330(coding)
ATGAGCAAAGTTAAAGCTGATATCTTTTATCAACACCATAAGCAGCTATTGAGTGTTTGG
AATAAGCAACCTCAATACGCCAATATCGATGCTTTTATTATTAAAAATGGTAAAGATCAA
GGTGGAAATAAAATCAAAACTTCTGCCATTTCTATGTGGTATTTTGGTTTCGACTTCATT
GACACTATCCTTTTGATCACTAAAAAGACTTTTGCCATTATTGGTGGTAACAAGAAAATA
AACATGTTAAAATCTGTCTAGGAACACGCAGAAGCAAAAGAATACAATTTAGTTTTCATC
GAAAAAGACTAAGCAAACAATTCCAATCAACTTTAATAATTATTTGAAATTCTTGACAAA
GATTTGAACAAATCTAGCTTCAATATTGGAACTCTAGCTAAAGAATAGCAAGTTGGCCCT
TTTATGACTGAGTATGACTCATTTATTAAAGACAAAAATTAATATAAATTTGCTGATTGC
AGTGTATTTGTATAAGATTGTCTCTCTGTAAAAGATCAAAATGAAATATCTTACATTGGA
AAAGCTGCTAAAGTTAGTGTCTATTTAGAGTCTAAATTGATAAAAGAAATTGAAACAATC
ATTGAAGATGAAGGTAAAAAGACTCACAGTCAAATTGCTACTATGATTGAAGGATTGATT
GAAAATGAAAAAGAACTTAAAAAGATCTCAGAAGAAATTGGAGGTGAGAGTGACAATCTT
GATTTGGCTTATGTCCCAATTGTCTAATCTGGCGGCAAATATGATTTAAAACCAAATGCT
TAATCTAATGAAGATATTCTTTCTTATGACACAATTATTGTTTCAGTAGGTACTAAATAT
ATGGAATATCATGCTAATATTGTTCGTACCCTTTTCATTGACCCAACAAACGACTAAAAG
AAGATTTATTAGAGAGTTTATGAGCTCTAAAACTAGATCGCTGTCTAACTTAAGCCTGGT
ATTAAGCTCAAAACTGTTTATGAAAATGCAGTTAATTTCATTAATGAGAAAGTACCTCAA
TTGAAGGATAAGATCCCAGCTAATTTTGGATTTGGTATTGGTTTAGAATTTAGAGAATCT
AACTTGTACATTAATGCTAAAAACGAAAAAGAAGTTGAAGAAGGTATGGTCTTCAATGTT
GTTGTTGGTTTTGACAACTTGCAAAGTGAAAAGGAGAAAGCTTATGCCATACAAATTTCT
GACACTGTTGCAATTAGAAAGTAAAACACACCCAATGCTGTCATGACATTCAAAGTTTCT
AAGAAATATGAAGACATTTCTTACAGCATTTAAGATGAGGGTCAAGATGAAGAATAAGAA
GAGGAAGAAGATGATTTAGAAAAGGAAAACATTATTTAAGATGGACGCAGAACAAGAAAT
GCCTATCACAAAAATACAACTATTGTTTCAGAAAAAGAAAGACAAAAACACTAACTTGAA
TTGAGAGAAGTCAAATTAAAAGAATTACAAGAAAGATATAATAACAATGGATTCTTATCA
AATAAGATCAATTCCAGAGCTCTTGAGTTAGATAAGGTCTAGTGTTATGGTGGACCTCAA
GATATTCCCAAAGAATATAAGAAAAATTAAATTCATATTGATGCTGCTCATAATGCAATC
TTACTTCCTGTAAATGGTGAACTAGTTCCCTTCCACATTTCCTTAATTAAAAACTACTCT
AAAAACGACGAAGGAAAGACTCACACATTACGTCTTAACTTCCACAATCCTGGTAGTGGC
AGCAATTTAGCCAATATTACTTTCCCTAAGATTGATGGCTAAATTGTCTTTATTAAAGAA
CTCACTTTCCGTTCAAAGAACGCTAAAAATATGTTGGAAACAATTAAGAAAATCAAAGAC
TTGCAAGCTAAAGTTAAACAAACTGATCAAGAAGCTAAAAATAAAGACGAATTAGTAGAG
CAAGACAAATTACAATTACGTAACACAAAGAGACCTGCTTTAAGAAATTTAAAAGTACGT
CCTGCTATTTCTAAATAAAAAGTAAATGGTATGTTGGAATTGCACTTAAATGGTTTCAGA
TATATGACAACTAAAAATGAAAAAGTTGATGTCATCTTTAAAAATATAAAACATGCCATC
TTCTAACCTTGCGATAACGAAATGATTGTTGCCATACATTTCAATCTCAAGAATCCTATT
ATGATAGGCAAAAAGAAAGTTTGGGATGTACAATTTTATACAGAAGCTGGTCTTCCCCCA
GAGGATTTAAATAACAGAAGAAGAGGTCATGACTACGATGAAATAGAAGAAGAATAAATG
GAAAAAGCTCGTAGAAAGAAATTAAATAAGGACTTCGAAGCCTTCTACAAAGAAGTTGAA
AACTAGCTTGGAGATAAAATTAAGTTTGAAGTTCCATATGCCAATCTCGGTTTCTACGGT
TCACCAAGTAGATCTACTTGCCTCCTTTAACCTACATAAAATACCCTTATGAACATCATT
GAATTCCCCTTCTTTATCATGTCCTTAGAAGAAGTAGAATTAGCATGCTTCGAAAGAATG
ATCGGAAGACTTAAAAACTTTGATCTTGTCTTTATTTTCAAGGATTATGAAAAACAAGTT
ACAAGAATTGCCTCTATTCCTATTGATAAGGCAGAAATAGTTAAAAATTGGTTAAACAGC
TAAAATATATTGTATTTTGAATCTACAAAGAGTTTCTCTTGGGCTAATATCTTAAAGACC
ATTCGCTAAGATATTGGTGGCTTCATTGAAGATGGAGGTTGGAATATTATTTTGGGTGAA
GATGAAGGAGAAGATGAAGATCCTGATGAGGGTGATGAAGATTTCTCAGTAGAACAAGAC
GAAGAGGAAGAAGAAAGTGAAGAGATTTCTGAAAGTGATGAGGATTTCGATGATGAAGAA
AGTGCGAGTGATTTTGAAGGAGATGAAGATCTCAGTGAAGAAGGCTAAAGCTGGAGCGAT
CTTGAAGAAAACGCTAGAAAGGAAGAAGAGAGAAGAAAGTAACAACAAGTAAAACCAACA
AAGCCTGTTCCTTAAAAAAGAAGATGA


>TTHERM_00283330(protein)
MSKVKADIFYQHHKQLLSVWNKQPQYANIDAFIIKNGKDQGGNKIKTSAISMWYFGFDFI
DTILLITKKTFAIIGGNKKINMLKSVQEHAEAKEYNLVFIEKDQANNSNQLQQLFEILDK
DLNKSSFNIGTLAKEQQVGPFMTEYDSFIKDKNQYKFADCSVFVQDCLSVKDQNEISYIG
KAAKVSVYLESKLIKEIETIIEDEGKKTHSQIATMIEGLIENEKELKKISEEIGGESDNL
DLAYVPIVQSGGKYDLKPNAQSNEDILSYDTIIVSVGTKYMEYHANIVRTLFIDPTNDQK
KIYQRVYELQNQIAVQLKPGIKLKTVYENAVNFINEKVPQLKDKIPANFGFGIGLEFRES
NLYINAKNEKEVEEGMVFNVVVGFDNLQSEKEKAYAIQISDTVAIRKQNTPNAVMTFKVS
KKYEDISYSIQDEGQDEEQEEEEDDLEKENIIQDGRRTRNAYHKNTTIVSEKERQKHQLE
LREVKLKELQERYNNNGFLSNKINSRALELDKVQCYGGPQDIPKEYKKNQIHIDAAHNAI
LLPVNGELVPFHISLIKNYSKNDEGKTHTLRLNFHNPGSGSNLANITFPKIDGQIVFIKE
LTFRSKNAKNMLETIKKIKDLQAKVKQTDQEAKNKDELVEQDKLQLRNTKRPALRNLKVR
PAISKQKVNGMLELHLNGFRYMTTKNEKVDVIFKNIKHAIFQPCDNEMIVAIHFNLKNPI
MIGKKKVWDVQFYTEAGLPPEDLNNRRRGHDYDEIEEEQMEKARRKKLNKDFEAFYKEVE
NQLGDKIKFEVPYANLGFYGSPSRSTCLLQPTQNTLMNIIEFPFFIMSLEEVELACFERM
IGRLKNFDLVFIFKDYEKQVTRIASIPIDKAEIVKNWLNSQNILYFESTKSFSWANILKT
IRQDIGGFIEDGGWNIILGEDEGEDEDPDEGDEDFSVEQDEEEEESEEISESDEDFDDEE
SASDFEGDEDLSEEGQSWSDLEENARKEEERRKQQQVKPTKPVPQKRR


>TTHERM_00283330(gene)
ATGAGCAAAGTTAAAGCTGATATCTTTTATCAACACCATAAGCAGCTATTGAGTGTTTGG
AATAAGGTAATTAGATATACTTTGTTAGCATTTTTTTATATTTTTAATTGCTGGTTTCCA
TTCACTAACTTTTCATTTTATATTCTAGCAACCTCAATACGCCAATATCGATGCTTTTAT
TATTAAAAATGGTAAAGATCAAGGTGGAAATAAAATCAAAACTTCTGCCATTTCTATGTG
GTATTTTGGTTTCGACTTCATTGACACTATCCTTTTGATCACTAAAAAGACTTTTGCCAT
TATTGGTGGTAACAAGAAAAGTAATTTTGCATTTCTAGAATAATTTCATGCATTAAATTT
GTGCTTGATAATGCCAACAATTAGCTAAATTATTTCAATTATAAAAAAGTAAACATGTTA
AAATCTGTCTAGGAACACGCAGAAGCAAAAGAATACAATTTAGTTTTCATCGAAAAAGAC
TAAGCAAACAATTCCAATCAACTTTAATAATTATTTGAAATTCTTGACAAAGATTTGAAC
AAATCTAGCTTCAATGTAAATTCAAATATTATATTTAAATTGAATTTAGACTCATTTTGT
GTCTCAACTGTAATTATGCAGACACAGGCAGGGATGAATCTGAAAGAATTTTAAGCAATT
AAAATAAATTTTATCAAATTTTAACAATTTATTAAAGATTGGAACTCTAGCTAAAGAATA
GCAAGTTGGCCCTTTTATGACTGAGTATGACTCATTTATTAAAGACAAAAATTAATATAA
ATTTGCTGATTGCAGTGTATTTGTATAAGATTGTCTCTCTGTAAAAGATCAAAATGAAAT
AGTAATTTATTTGATATTTAAATTTAGAATACAATTTTTTAAGATAATTATCTGAAAGAG
TTTTAGAAGCTTTTCTTTTGACATAATTTGTTTATTTTGATTTCATTATTTTATTAAACT
TTCTATCCATAACTAAAACAGTCTTACATTGGAAAAGCTGCTAAAGTTAGTGTCTATTTA
GAGTCTAAATTGATAAAAGAAATTGAAACAATCATTGAAGATGAAGGTAAAAAGACTCAC
AGTCAAATTGCTACTATGATTGAAGGATTGATTGAAAATGAAAAAGAACTTAAAAAGATC
TCAGAAGTAAAAAATATTTAACATTATTTAAGTAAAAGCAATATAAAGCAAAGTTCATTC
AAAAAAGCATTGATTATCAAAATTTTCATTTAAGTGCATGATAATTTAAATAAAATAAAA
CGAAGTTTCATTAGGAACTTATAGCAAACAGCAGCAATATAATCATTTGAAATTATGAAT
AGCATTAAGTTATTAAATTTAAAATTTAAATTTATAGGAAATTGGAGGTGAGAGTGACAA
TCTTGATTTGGCTTATGTCCCAATTGTCTAATCTGGCGGCAAATATGATTTAAAGTAAAT
AACTACTTATCCATTTAAAAAATTAAATAAAATACTCATTAAAATATCAATAGACCAAAT
GCTTAATCTAATGAAGATATTCTTTCTTATGACACAATTATTGTTTCAGTAGGTACTAAA
TATATGGAATATCATGCTAATATTGTTCGTACCCTTTTCATTGACCCAACAAACGACTAA
AAGAAGATTTATTAGAGAGTTTATGAGCTCTAAAACTAGATCGCTGTCTAACTTAAGCCT
GGTATTAAGCTCAAAACTGTTTATGAAAATGCAGTTAATTTCATTAATGAGAAAGTACCT
CAATTGAAGGATAAGATCCCAGCTAATTTTGGATTTGGTGTAATAATTTATTTACAATTT
GAGTGCTTTAGCAAGTAATTTAAATTTTTATATTGTATGATAATAGATTGGTTTAGAATT
TAGAGAATCTAACTTGTACATTAATGCTAAAAACGAAAAAGAAGTTGAAGAAGGTATGGT
CTTCAATGTTGTTGTTGGTTTTGACAACTTGCAAAGTGAAAAGGAGAAAGCTTATGCCAT
ACAAATTTCTGACACTGTTGCAATTAGAAAGTAAAACACACCCAATGCTGTCATGACATT
CAAAGTTTCTAAGAAATATGAAGACATTTCTTACAGCATTTAAGATGAGGGTCAAGATGA
AGAATAAGAAGAGGAAGAAGATGATTTAGAAAAGGAAAACATTATTTAAGATGGACGCAG
AACAAGAAATGCCTATCACAAAAATACAACTATTGTTTCAGAAAAAGAAAGACAAAAACA
CTAACTTGAATTGAGAGAAGTCAAATTAAAAGAATTACAAGAAAGATATAATAACAATGG
ATTCTTATCAAATAAGATCAATTCCAGAGCTCTTGAGTTAGATAAGGTCTAGTGTTATGG
TGGACCTCAAGATATTCCCAAAGAATATAAGAAAAATTAAATTCATATTGATGCTGCTCA
TAATGCAATCTTACTTCCTGTAAATGGTGAACTAGTTCCCTTCCACATTTCCTTAATTAA
AAACTACTCTAAAAACGACGAAGGAAAGACTCACACATTACGTCTTAACTTCCACAATGT
AAATAAATATATTAATTTTTACTCATTTTCAAATAATTTATTAATATTATTTACTTTTAA
AAAATAATTAGCCTGGTAGTGGCAGCAATTTAGCCAATATTACTTTCCCTAAGATTGATG
GCTAAATTGTCTTTATTAAAGAACTCACTTTCCGTTCAAAGAACGCTAAAAATATGTTGG
AAACAATTAAGAAAATCAAAGACTTGCAAGCTAAAGTTAAACAAACTGATCAAGAAGCTA
AAAATAAAGACGAATTAGTAGAGCAAGACAAATTACAATTACGTAACACAAAGAGACCTG
CTTTAAGAAATTTAAAAGTACGTCCTGCTATTTCTAAATAAAAAGTAAATGGTATGTTGG
AATTGCACTTAAATGGTTTCAGATATATGACAACTAAAAATGAAAAAGTTGATGTCATCT
TTAAAAATATAAAACATGCCATCTTCTAACCTTGCGATAACGAAATGATTGTTGCCATAC
ATTTCAATCTCAAGAATCCTATTATGATAGGCAAAAAGAAAGTTTGGGATGTACAATTTT
ATACAGAAGCTGGTCTTCCCCCAGAGGATTTAAGTAAGAGAATTTAACATTTTTTTAATG
TTTATTAATAAAATTTAAATTAAATTAATAAAGATAACAGAAGAAGAGGTCATGACTACG
ATGAAATAGAAGAAGAATAAATGGAAAAAGCTCGTAGAAAGAAATTAAATAAGGACTTCG
AAGCCTTCTACAAAGAAGTTGAAAACTAGCTTGGAGATAAAATTAAGTTTGAAGTTCCAT
ATGCCAATCTCGGTTTCTACGGTTCACCAAGTAGATCTACTTGCCTCCTTTAACCTACAT
AAAATACCCTTATGAACATCATTGAATTCCCCTTCTTTATCATGTCCTTAGAAGAAGTAG
AATTAGCATGCTTCGAAAGAATGATCGTAAATAAATTAAAAAAAATTCTATTTAATCAAT
CAAAAAATTTATATAAACTGAATATTTATTTATTTACTTACTTACTTACTTACTTACTAA
CACATTTTTATTTAACTAATTTAGGGAAGACTTAAAAACTTTGATCTTGTCTTTATTTTC
AAGGATTATGAAAAACAAGTTACAAGAATTGCCTCTATTCCTATTGATAAGGCAGAAATA
GTTAAAAATTGGTTAAACAGCTAAAATATATTGTATTTTGAATCTACAAAGAGTTTCTCT
TGGGCTAATATCTTAAAGACCATTCGCTAAGATATTGGTGGCTTCATTGAAGATGGAGGT
TGGAATATTATTTTGGGTGAAGATGAAGGAGAAGATGAAGATCCTGATGAGGGTGATGAA
GATTTCTCAGTAGAACAAGACGAAGAGGAAGAAGAAAGTGAAGAGATTTCTGAAAGTGAT
GAGGATTTCGATGATGAAGAAAGTGCGAGTGATTTTGAAGGAGATGAAGATCTCAGTGAA
GAAGGCTAAAGCTGGAGCGATCTTGAAGAAAACGCTAGAAGTAATTAATTAATTAATTTT
TATCAATAATTGATAAATTTAAGAATAATCTAATTTATTTTTAATAATACAGAGGAAGAA
GAGAGAAGAAAGTAACAACAAGTAAAACCAACAAAGCCTGTTCCTTAAAAAAGAAGATGA