Identifiers and Description

Gene Model Identifier

TTHERM_00194330

Standard Name

CEN7 (CENtrin 7)

Aliases

PreTt06717 | 16.m00373

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00194330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03704.11.999787596754473e-118EF hand family protein (183 aa
)
OxytrichaContig330.1.g1255.998566275848171e-59EF hand
DictyBaseDDB_G02794071.999981404597394e-31calA on chromosome: 3 position
2244074 to 2245039
WormBaseWBGene000005526.002270911168926e-31locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
SGDYOR257W2.0008113830639685e-30CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation
Stentor CoeruleusSteCoe_5171.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194330(coding)
ATGATAAACAATTATAAGAAGAGCGGAAACATATTAAACACTTAGAAGTTTTTAAAAACA
AAGAATGTTAGGTAATTAGACGAAGAAACCCTAAATGAACTTAGGGAAGCATTTAACTTA
TTTGATACCTAACATTCAGGAGAAATAGATTCGAGAGAGTTGAAAGCCATAATGAGAGCA
TTTGGATTAGATGTTAAGAAAGATTAAATTACTCTGATATATAAGGAATTAAATAAAGAT
ATAAATGAAGGCATTAATTTTTAAGAATTCACAAATATAATGGCACCAAAACTTGGTTCA
AAAGATACAAAAGAAGAAATTGAAAGAATATTTTAATTGTTTGACGAAGAAAGATAGGGT
AGAATTTCATTTTAAAATCTTAAAAAAATAGCTTCTGAAATAGGAGAGGAAATTAGTGAT
GAAGAATTATATGAAATGATTGAAGAAGCAGATAGAGATGGAGATGGGTGTTTAAATTTT
AATGAGTTTTATAGAATAATGAAAAAGAGAGAAGATCCTTTGGATGATTATGATAGTGAT
CTTGAGTGA


>TTHERM_00194330(protein)
MINNYKKSGNILNTQKFLKTKNVRQLDEETLNELREAFNLFDTQHSGEIDSRELKAIMRA
FGLDVKKDQITLIYKELNKDINEGINFQEFTNIMAPKLGSKDTKEEIERIFQLFDEERQG
RISFQNLKKIASEIGEEISDEELYEMIEEADRDGDGCLNFNEFYRIMKKREDPLDDYDSD
LE


>TTHERM_00194330(gene)
ATGATAAACAATTATAAGAAGAGCGGAAACATATTAAACACTTAGAAGTTTTTAAAAACA
AAGAATGTTAGGTAATTAGACGAAGAAACCCTAAATGAACTTAGGGAAGCATTTAACTTA
TTTGATACCTAACATTCAGGAGAAATAGATTCGAGAGAGTTGAAAGCCATAATGAGAGCA
TTTGGATTAGATGTTAAGAAAGATTAAATTACTCTGATATATAAGGAATTAAATAAAGAT
ATAAATGAAGGCATTAATTTTTAAGAATTCACAAATATAATGGCACCAAAACTTGTAAAT
AAACCTATCATTTAAAATTAGAGAAATATTAAATGTAACTTAAATTCAAAAATAATTAGG
GTTCAAAAGATACAAAAGAAGAAATTGAAAGAATATTTTAATTGTTTGACGAAGAAAGAT
AGGGTAGAATTTCATTTTAAAATCTTAAAAAAATAGCTTCTGAAATAGGTAAATATAAAA
GTTATTTGACTAGTATTTTCTAATAAATTTATTTACAATAGGAGAGGAAATTAGTGATGA
AGAATTATATGAAATGATTGAAGAAGCAGATAGAGATGGAGATGGGTGTTTAAATTTTAA
TGAGTTTTATAGAATAATGAAAAAGAGAGAAGATCCTTTGGATGATTATGATAGTGATCT
TGAGTGA