Identifiers and Description

Gene Model Identifier

TTHERM_00052500

Standard Name

CEN5 (CENtrin 5)

Aliases

PreTt11430 | 3.m01709 | 3824.m03185

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00052500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01519.11.999447289884935e-116EF hand family protein (209 aa
)
OxytrichaContig1124.1.g1118.00344477495519e-22EF hand
DictyBaseDDB_G02794070.0000000029989608248573072calA on chromosome: 3 position
2244074 to 2245039
WormBaseWBGene000005520.0000000039998859049333245locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
SGDYBR109C0.0000029996948234116693CMD1 Calmodulin; Ca++ binding
protein that regulates Ca++ in
dependent processes (mitosis,
bud growth, actin organization
, endocytosis, etc.) and Ca++
dependent processes (stress-ac
tivated pathways), targets inc
lude Nuf1p, Myo2p and calcineu
rin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000243

Sequences

>TTHERM_00052500(coding)
ATGTCTCGAAGTTCAATGTTTAGCTCTCCTTTAAAGAGAGAAAGACCCTCATCAATATAT
CACAACAACTTTAATAATCTTGGTGTAGTAAACTAAAATGATTTATCATATAATAGTTAA
CTGAGTGAAAGTTAAGCTTTCTCAAATAAAGTTTTTGATGCTAAAGATTATGCTACAGAT
GGTCTTACTGAATAAGAAGTTCACATATACAAATAGGTTTTTGACCTTTATGATTAAACA
GGAGAAGGGTATTTAAATCCTGGTAAGATTAGAAATGCAATGAAAAAATATGGCAACTAT
AATGCAAGTTTGCAATTAGTTTATGAAATACAATCAAATTTTGATAATAACTTAGATGGT
AAAATTGATTTCGAAGAATTTGTTAGAATGATGAGGATGAAACCTTGCTAATAAGACTCT
GCTGAAGATGTCAAACATATTTTCTAATAAATATCAAATTACTAAGATGAAGGAATAACA
CCAGAAGATTTAGTGGAACTGGCTTTAAGTTGCAATGATACATTATCGTATGAAGATGCT
GTAAAAATTATAAAAAAATTAGAACCAAACAGTGAAAAGCTGTCTATGAAGAAGTTTATT
GAATTCAATTTGAGATGCGAATTTTGA


>TTHERM_00052500(protein)
MSRSSMFSSPLKRERPSSIYHNNFNNLGVVNQNDLSYNSQLSESQAFSNKVFDAKDYATD
GLTEQEVHIYKQVFDLYDQTGEGYLNPGKIRNAMKKYGNYNASLQLVYEIQSNFDNNLDG
KIDFEEFVRMMRMKPCQQDSAEDVKHIFQQISNYQDEGITPEDLVELALSCNDTLSYEDA
VKIIKKLEPNSEKLSMKKFIEFNLRCEF


>TTHERM_00052500(gene)
ATGTCTCGAAGTTCAATGTTTAGCTCTCCTTTAAAGAGAGAAAGACCCTCATCAATATAT
CACAACAACTTTAATAATCTTGGTGTAGTAAACTAAAATGATTTATCATATAATAGTTAA
CTGAGTGAAAGTTAAGCTTTCTCAAATAAAGTTTTTGATGCTAAAGATTATGCTACAGAT
GGTCTTACTGAATAAGAAGTTCACATATACAAATAGGTTTTTGACCTTTATGATTAAACA
GGAGAAGGGTATTTAAATCCTGGTAAGATTAGAAATGCAATGAAAAAATATGGCAACTAT
AATGCAAGTTTGCAATTAGTTTATGAAATACAATCAAATTTTGATAATAACTTAGATGGT
AAAATTGATTTCGAAGAATTTGTTAGAATGATGAGGATGAAACCTTGCTAATAAGACTCT
GCTGAAGATGTCAAACATATTTTCTAATAAATATCAAATTACTAAGATGAAGGAATAACA
CCAGAAGATTTAGTGGAACTGGCTTTAAGTTGCAATGATACATTATCGTATGAAGATGCT
GTAAAAATTATAAAAAAATTAGAACCAAACAGTGAAAAGCTGTCTATGAAGAAGTTTATT
GAATTCAATTTGAGATGCGAATTTTGA