Identifiers and Description

Gene Model Identifier

TTHERM_00444870

Standard Name

CEN4 (CENtrin 4)

Aliases

PreTt03855 | 51.m00221 | 3704.m00077

Description

CEN4 caltractin ICL1d; EF hand family protein- centrin family member; EF-hand calcium-binding protein; also called caltractin; GFP-fusion protein localized to specialized structures of oral apparatus- along deep rootlet- and at contractile vacuole pore

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00444870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10867.14.9996115996408327e-110EF hand family protein (175 aa
)
OxytrichaContig22557.0.g479.004385969422137e-73EF-hand domain pair
Stentor CoeruleusSteCoe_375043.6251409191435593e-34
SGDYOR257W3.000555717977434e-27CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation
DictyBaseDDB_G02794073.0002687256732656e-20calA on chromosome: 3 position
2244074 to 2245039
WormBaseWBGene000005521.9999391735788327e-19locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19
  2. Ref:9163921: Guerrini AM, Ascenzioni F, Gallo T, Donini P (1997) Yeast linear plasmids with T2AG3 telomeres: TEL+CEN antagonism and genetic and molecular stability. FEMS microbiology letters 150(1):165-71
  3. Ref:2190243: Ascenzioni F, Guerrini AM, Donini P (1990) Functional telomere formation in yeast using synthetic C4A2 sequences. Plasmid 23(1):16-26

Sequences

>TTHERM_00444870(coding)
ATGAATTCAAAGAAAACTGTTGCTCCTTAAGGTAAAAATTTTGGCGTTGCTAACAAGAAG
TAACCTTAATAAAGACCTGGTTTGACTGAAGATGAAATTGAAGAAATAAGAGAAGCCTTC
AACTTATTCGATACTGAAGGTTCTGGTAAGATTGATCCCAGAGAATTAAAAGCAGCCATG
CAATCGTTGGGTTTTGAAAATAAGAATCCTACTATCTATGGTATGATCGCTGATTTAGAA
AGTTAAGGAACAGAAATTGATTTTGAAGATTTCTTAGATGCTATTACCTCAAAGCTTGGA
GACAAAGAAACTAGAGACGGAATTAACAAAATCTTTGAGTTATTTGATGATGATTAAACT
AAGAGTATTACTTTGAAGAATTTAATGCGTGTTGCTAAGGAATTAGGTGAAACAATGACC
TAAGAAGAATTAGCTGAGATGTTAGAACGTGCCGCTAGCAATAGCAGAGAAATTACCCCT
GAAGATTTCTACAACATCATGGTCAAGAAAACTTTCTGA


>TTHERM_00444870(protein)
MNSKKTVAPQGKNFGVANKKQPQQRPGLTEDEIEEIREAFNLFDTEGSGKIDPRELKAAM
QSLGFENKNPTIYGMIADLESQGTEIDFEDFLDAITSKLGDKETRDGINKIFELFDDDQT
KSITLKNLMRVAKELGETMTQEELAEMLERAASNSREITPEDFYNIMVKKTF


>TTHERM_00444870(gene)
ATGAATTCAAAGAAAACTGTTGCTCCTTAAGGTAAAAATTTTGGCGTTGCTAACAAGAAG
TAACCTTAATAAAGACCTGGTTTGACTGAAGATGAAATTGAAGAAATAAGAGAAGCCTTC
AACTTATTCGATACTGAAGGTTCTGGTAAGATTGATCCCAGAGAATTAAAAGCAGCCATG
CAATCGTTGGGTTTTGAAAATAAGAATCCTACTATCTATGGTATGATCGCTGATTTAGAA
AGTTAAGGAACAGAAATTGATTTTGAAGATTTCTTAGATGCTATTACCTCAAAGCTTGGA
GACAAAGAAACTAGAGACGGAATTAACAAAATCTTTGAGTTATTTGATGATGATTAAACT
AAGAGTATTACTTTGAAGAATTTAATGCGTGTTGCTAAGGAATTAGGTGAAACAATGACC
TAAGAAGAATTAGCTGAGATGTTAGAACGTGCCGCTAGCAATAGCAGAGAAATTACCCCT
GAAGATTTCTACAACATCATGGTCAAGAAAACTTTCTGA