Identifiers and Description

Gene Model Identifier

TTHERM_00444870

Standard Name

CEN4 (CENtrin 4)

Aliases

PreTt03855 | 51.m00221 | 3704.m00077

Description

EF hand family protein, centrin family member; EF-hand calcium-binding protein; also called caltractin; GFP-fusion protein localized to specialized structures of oral apparatus, along deep rootlet, and at contractile vacuole pore

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00444870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10867.14.9996115996408327e-110EF hand family protein (175 aa
)
OxytrichaContig22557.0.g479.004385969422137e-73EF-hand domain pair
Stentor CoeruleusSteCoe_375043.6251409191435593e-34
SGDYOR257W3.000555717977434e-27CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation
DictyBaseDDB_G02794073.0002687256732656e-20calA on chromosome: 3 position
2244074 to 2245039
WormBaseWBGene000005521.9999391735788327e-19locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19
  2. Ref:9163921: Guerrini AM, Ascenzioni F, Gallo T, Donini P (1997) Yeast linear plasmids with T2AG3 telomeres: TEL+CEN antagonism and genetic and molecular stability. FEMS microbiology letters 150(1):165-71
  3. Ref:2190243: Ascenzioni F, Guerrini AM, Donini P (1990) Functional telomere formation in yeast using synthetic C4A2 sequences. Plasmid 23(1):16-26

Sequences

>TTHERM_00444870(coding)
ATGAATTCAAAGAAAACTGTTGCTCCTTAAGGTAAAAATTTTGGCGTTGCTAACAAGAAG
TAACCTTAATAAAGACCTGGTTTGACTGAAGATGAAATTGAAGAAATAAGAGAAGCCTTC
AACTTATTCGATACTGAAGGTTCTGGTAAGATTGATCCCAGAGAATTAAAAGCAGCCATG
CAATCGTTGGGTTTTGAAAATAAGAATCCTACTATCTATGGTATGATCGCTGATTTAGAA
AGTTAAGGAACAGAAATTGATTTTGAAGATTTCTTAGATGCTATTACCTCAAAGCTTGGA
GACAAAGAAACTAGAGACGGAATTAACAAAATCTTTGAGTTATTTGATGATGATTAAACT
AAGAGTATTACTTTGAAGAATTTAATGCGTGTTGCTAAGGAATTAGGTGAAACAATGACC
TAAGAAGAATTAGCTGAGATGTTAGAACGTGCCGCTAGCAATAGCAGAGAAATTACCCCT
GAAGATTTCTACAACATCATGGTCAAGAAAACTTTCTGA


>TTHERM_00444870(protein)
MNSKKTVAPQGKNFGVANKKQPQQRPGLTEDEIEEIREAFNLFDTEGSGKIDPRELKAAM
QSLGFENKNPTIYGMIADLESQGTEIDFEDFLDAITSKLGDKETRDGINKIFELFDDDQT
KSITLKNLMRVAKELGETMTQEELAEMLERAASNSREITPEDFYNIMVKKTF


>TTHERM_00444870(gene)
ATGAATTCAAAGAAAACTGTTGCTCCTTAAGGTAAAAATTTTGGCGTTGCTAACAAGAAG
TAACCTTAATAAAGACCTGGTTTGACTGAAGATGAAATTGAAGAAATAAGAGAAGCCTTC
AACTTATTCGATACTGAAGGTTCTGGTAAGATTGATCCCAGAGAATTAAAAGCAGCCATG
CAATCGTTGGGTTTTGAAAATAAGAATCCTACTATCTATGGTATGATCGCTGATTTAGAA
AGTTAAGGAACAGAAATTGATTTTGAAGATTTCTTAGATGCTATTACCTCAAAGCTTGGA
GACAAAGAAACTAGAGACGGAATTAACAAAATCTTTGAGTTATTTGATGATGATTAAACT
AAGAGTATTACTTTGAAGAATTTAATGCGTGTTGCTAAGGAATTAGGTGAAACAATGACC
TAAGAAGAATTAGCTGAGATGTTAGAACGTGCCGCTAGCAATAGCAGAGAAATTACCCCT
GAAGATTTCTACAACATCATGGTCAAGAAAACTTTCTGA