Identifiers and Description

Gene Model Identifier

TTHERM_00689850

Standard Name

CEN3 (CENtrin 3)

Aliases

PreTt23181 | 105.m00148 | 3737.m00060

Description

Centrin family member; EF-hand calcium-binding protein; also called caltractin; GFP-fusion protein localized to specialized structures in the oral apparatus and along deep rootlet

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00689850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16629.14.99876080819921e-108EF hand family protein (171 aa
)
OxytrichaContig1290.1.g712.999564368270328e-76EF hand
Stentor CoeruleusSteCoe_341453.6251409191435593e-34
WormBaseWBGene000005524.000054831110256e-33locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
DictyBaseDDB_G02794076.99868990988981e-32calA on chromosome: 3 position
2244074 to 2245039
SGDYOR257W5.000574419929632e-30CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19

Sequences

>TTHERM_00689850(coding)
ATGAATCAAAGAAAGAATTAAACCTAACAAAAGAAATTTAATCCTGCAGATTATGTTAGA
CCAGGTGTTACTGAAGACGAAGTCATCGAAATTAAGGAAGCCTTTGATCTTTTCGATATG
GATCTTGGTGGCACAATTGATCCTTCTGAACTTCAAGCTGCTATGAGATCATTGGGTTTC
GAAGCAAAAAATTAAACAATTTATAAAATGATTGCAGATCTTGATACTGATCAAAGTGGT
TAAATCAATTTCGCTGAATTCTTAAATTTGATGACCGCTCGTATCTCTGATAAGGACTCA
AGAGAAGATATCAGAAAAGTTTTCATGCTTTTCAATGACGAAAACAATGTTGGTATCTCA
ATTAAGTAACTTCGTAGAATTGCCCAAGAATTAGGTGAATAAATGGATGATTCTGAATTA
TAAGAAATGATTGAAAGAGCTGATTCAAATGGTGATGGATTGGTAACAGAAGATGATTTC
TACAATATTATGACAAAGAAAAATTTTGTTTGA


>TTHERM_00689850(protein)
MNQRKNQTQQKKFNPADYVRPGVTEDEVIEIKEAFDLFDMDLGGTIDPSELQAAMRSLGF
EAKNQTIYKMIADLDTDQSGQINFAEFLNLMTARISDKDSREDIRKVFMLFNDENNVGIS
IKQLRRIAQELGEQMDDSELQEMIERADSNGDGLVTEDDFYNIMTKKNFV


>TTHERM_00689850(gene)
ATGAATCAAAGAAAGAATTAAACCTAACAAAAGAAATTTAATCCTGCAGATTATGTTAGA
CCAGGTGTTACTGAAGACGAAGTCATCGAAATTAAGGAAGCCTTTGATCTTTTCGATATG
GATCTTGGTGGCACAATTGATCCTTCTGAACTTCAAGCTGCTATGAGATCATTGGGTTTC
GAAGCAAAAAATTAAACAATTTATAAAATGATTGCAGATCTTGATACTGATCAAAGTGGT
TAAATCAATTTCGCTGAATTCTTAAATTTGATGACCGCTCGTATCTCTGATAAGGACTCA
AGAGAAGATATCAGAAAAGTTTTCATGCTTTTCAATGACGAAAACAATGTTGGTATCTCA
ATTAAGTAACTTCGTAGAATTGCCCAAGAATTAGGTGAATAAATGGATGATTCTGAATTA
TAAGAAATGATTGAAAGAGCTGATTCAAATGGTGATGGATTGGTAACAGAAGATGATTTC
TACAATATTATGACAAAGAAAAATTTTGTTTGA