Identifiers and Description

Gene Model Identifier

TTHERM_00523060

Standard Name

CEN2 (CENtrin 2)

Aliases

PreTt12421 | 65.m00239 | 3717.m00118

Description

Centrin family member, EF-hand calcium-binding protein; basal bodies require a centrin from both CEN1 and CEN2 to function correctly; expression of endogenous gene not detected during vegetative growth or conjugation series

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00523060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12795.19.997093137033517e-262EF hand family protein (368 aa
)
OxytrichaContig473.1.g500.0005997485943342685GCC2 and GCC3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23087207: Vonderfecht T, Cookson MW, Giddings TH, Clarissa C, Winey M (2012) The two human centrin homologues have similar but distinct functions at Tetrahymena basal bodies. Molecular biology of the cell 23(24):4766-77
  2. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19

Sequences

>TTHERM_00523060(coding)
ATGGAATCATATTCTTATAATTCAGGTCTAAAAGAAGTTACCTTTGATGAAAAAGAATCT
ATGTCAGAAAGAGGAACCTCTTTAGGAGGAGATGATTATCATCTAACAGAATCAGTGATA
GATAAATAAATGAAGGATTTCTAACAAGATAGAAGGAGTTTAGAAGATCCTGATTAGATT
AACTTTAATGACCCAATATTTAAAAGGATCTTGGGAGATGACGAGTTAAAGACGTTAGAC
TAAACTCTACCTTAAAAGTGTATCAAATGTGAATGCAAATTTAATTCTATAACTAATAGG
AAGTTTCAGTGTTACTTTTGTGGGTATCCAGTTTGCAAAGACCATTCTAAAAAAAAGAGA
GAAGATCCCTCAAAGCTAAACACAAGCAATAACAAGTCAATAAATAATCAAAATAATAGT
ACTATATTGAATACATCTGGAGGAGAAAGTGAATATGAAAAAAAAAATTTTAAGAAAATA
TGTGACATTTGTGAAGATAAATATCTGAAGTGGCAAATAAACTTTTCATTCTAGTAAAAG
AAGGATCAATATGATGAAGTTACATAAAGGTTAGAAAAATAACAAAAAGATATTTTAGAA
AAAATAAAAAAATAATAAGACGAAATAAGTAGAATATAGTCATAGGAAGAACAAAAAAAG
AAACAGTTTGAAGATTAAAAGAATGAAATATTAAAGAAGATTGAAAAAGCAGAAATGGAG
GATACAGATCTTAAAAAGGAAAACAAAGACTATTTATTAAAAATAGATAAAATAGATACT
GAAATTAATAGCATGATGAAATAAATAAAAGAAATCGATGAGGAATATAAGCAAAAGGTA
ACAGAAGAAAAGAATTTAACCTAAAAAATAAAAGAAATAGACTAAGAAATAGAAAATGCT
CACTAAATTATTGAAGAAATAGAATAAAAAATCACAGACAATAATCTGATGATGTAGAGA
TAAAAGTAAATTTATGATGTCAGAGATTCTCGTTTAGATAGCAATTTAGATAATATTAGA
GAAAACTCTGCAATTAGAGCTAGAAAAGATTAGAATATAGATAAAGAAAAAAATTGTAAT
GTATGCTAAATCTTTTGA


>TTHERM_00523060(protein)
MESYSYNSGLKEVTFDEKESMSERGTSLGGDDYHLTESVIDKQMKDFQQDRRSLEDPDQI
NFNDPIFKRILGDDELKTLDQTLPQKCIKCECKFNSITNRKFQCYFCGYPVCKDHSKKKR
EDPSKLNTSNNKSINNQNNSTILNTSGGESEYEKKNFKKICDICEDKYLKWQINFSFQQK
KDQYDEVTQRLEKQQKDILEKIKKQQDEISRIQSQEEQKKKQFEDQKNEILKKIEKAEME
DTDLKKENKDYLLKIDKIDTEINSMMKQIKEIDEEYKQKVTEEKNLTQKIKEIDQEIENA
HQIIEEIEQKITDNNLMMQRQKQIYDVRDSRLDSNLDNIRENSAIRARKDQNIDKEKNCN
VCQIF


>TTHERM_00523060(gene)
ATGGAATCATATTCTTATAATTCAGGTCTAAAAGAAGTTACCTTTGATGAAAAAGGTTTA
TTTTTTATTCTTCTACTATTTAAACGCTTAACTGTAAATAATTAATGTTCTATTTTCTAA
CATGAATAGAATCTATGTCAGAAAGAGGAACCTCTTTAGGAGGAGATGATTATCATCTAA
CAGAATCAGTGATAGATAAATAAATGAAGGATTTCTAACAAGATAGAAGGAGTTTAGAAG
ATCCTGATTAGATTAACTTTAATGACCGTACAAAAATTTTAATTCACTAGATTATGCAAT
TTTTTTATCAGCAATATTTAAAAGGATCTTGGGAGATGACGAGTTAAAGACGTTAGACTA
AACTCTACCTTAAAAGTGTATCAAATGTGAATGCAAATTTAATTCTATAACTAATAGGAA
GTTTCAGTGGTAATTTAATTATAGATTAGCTCATCATATGTTTATATTTAGAATTTAAAA
TTTAAAATATGAAGAATTTAAGCAGTTTTTAATCCTATTTTTAGAATAAAATGTTGTTGA
GGTTCGTTTTTTAGAATTTTAATTTCTTAAAATAAAAGTTACTTTTGTGGGTATCCAGTT
TGCAAAGACCATTCTAAAAAAAAGAGAGAAGATCCCTCAAAGCTAAACACAAGCAATAAC
AAGTCAATAAATAATCAAAATAATAGTACTATATTGAATACATCTGGAGGAGAAAGTGAA
TATGAAAAAAAAAATTTTAAGAAAATATGTGACATTTGTGAAGATAAATATCTGAAGTGG
CAAATAAACTTTTCATTCTAGTAAAAGAAGGATCAATATGATGAAGTTACATAAAGGTTA
GAAAAATAACAAAAAGATATTTTAGAAAAAATAAAAAAATAATAAGACGAAATAAGTAGA
ATATAGTCATAGGTAAAACCAATAAATATTAAATGAAGTTTATCTTTAATTGCCTAAACA
ATAATTATTTATTTAAATAGGAAGAACAAAAAAAGAAACAGTTTGAAGATTAAAAGAATG
AAATATTAAAGAAGATTGAAAAAGCAGAAATGGAGGATACAGATCTTAAAAAGGAAAACA
AAGACTATTTATTAAAAATAGATAAAATAGATACTGAAATTAATAGCATGATGAAATAAA
TAAAAGAAATCGATGAGGAATATAAGCAAAAGTATTTAATTAATCAATTTACTTTATTTA
TTTATTTAGTATTTATAGTTAATCAACATATATTTTAAAATGCTATTAGGGTAACAGAAG
AAAAGAATTTAACCTAAAAAATAAAAGAAATAGACTAAGAAATAGAAAATGCTCACTAAA
TTATTGAAGAAATAGAATAAAAAATCACAGACAATAATCTGATGATGTAGAGATAAAAGT
AAATTTATGATGTCAGAGATTCTCGTTTAGATAGCAATTTAGATAATATTAGAGAAAACT
CTGCAATTAGAGCTAGAAAAGATTAGAATATAGATAAAGAAAAAAATTGTAATGTATGCT
AAATCTTTTGA