Identifiers and Description

Gene Model Identifier

TTHERM_00384910

Standard Name

CEN1 (CENtrin 1 )

Aliases

PreTt24783 | 41.m00190 | centrin

Description

Centrin; EF Hand Ca2+ binding protein; alters MT sliding velocity to regulate ciliary beat form; localizes to basal bodies, oral apparatus cortical fibers, ciliary rootlets, the apical filament ring, and axonemal 14S inner arm dynein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00384910

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD03272 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::CEN1
  • ( SD03273 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-22
  • ( SD03274 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-29
  • ( SD03275 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-49
  • ( SD03276 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-58
  • ( SD03277 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-60
  • ( SD03278 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-86
  • ( SD03279 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-94
  • ( SD03280 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-103
  • ( SD03281 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-126
  • ( SD03282 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-134
  • ( SD03283 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-C-term∆
  • ( SD03284 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF1
  • ( SD03285 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF2
  • ( SD03286 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF1-EF2
  • ( SD03287 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF3
  • ( SD03288 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF3
  • ( SD03289 ) Micronucleus: cen1-1[∆::NEO2]
  • ( SD03290 ) Micronucleus: cen1-1[∆::NEO2]

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04411.19.004285235721242e-114EF hand family protein (168 aa
)
OxytrichaContig13931.0.g329.999030951775615e-88EF hand
SGDYOR257W6.997794455893953e-54CDC31 Calcium-binding componen
t of the spindle pole body (SP
B) half-bridge, required for S
PB duplication in mitosis and
meiosis II; homolog of mammali
an centrin; binds multiubiquit
inated proteins and is involve
d in proteasomal protein degra
dation
WormBaseWBGene000005522.0008536325002377e-42locus:cmd-1 Calmodulin sta
tus:Confirmed UniProt:O16305
protein_id:CCD69969.1
DictyBaseDDB_G02794074.001118334825066e-42calA on chromosome: 3 position
2244074 to 2245039
Stentor CoeruleusSteCoe_197722.2273635617957438e-39

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21562224: Vonderfecht T, Stemm-Wolf AJ, Hendershott M, Giddings TH, Meehl JB, Winey M (2011) The two domains of centrin have distinct basal body functions in Tetrahymena. Molecular biology of the cell 22(13):2221-34
  2. Ref:17785518: Kilburn CL, Pearson CG, Romijn EP, Meehl JB, Giddings TH, Culver BP, Yates JR, Winey M (2007) New Tetrahymena basal body protein components identify basal body domain structure. The Journal of cell biology 178(6):905-12
  3. Ref:16228897: Libusová L, Sulimenko T, Sulimenko V, Janisch R, Hozák P, Dráber P (2005) Distinct localization of a beta-tubulin epitope in the Tetrahymena thermophila and Paramecium caudatum cortex. Protoplasma 225(3-4):157-67
  4. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19
  5. Ref:15134263: McLaughlin NB, Buhse HE (2004) Localization by indirect immunofluorescence of tetrin, actin, and centrin to the oral apparatus and buccal cavity of the macrostomal form of Tetrahymena vorax. The Journal of eukaryotic microbiology 51(2):253-7
  6. Ref:12529441: Guerra C, Wada Y, Leick V, Bell A, Satir P (2003) Cloning, localization, and axonemal function of Tetrahymena centrin. Molecular biology of the cell 14(1):251-61
  7. Ref:12356864: Shang Y, Li B, Gorovsky MA (2002) Tetrahymena thermophila contains a conventional gamma-tubulin that is differentially required for the maintenance of different microtubule-organizing centers. The Journal of cell biology 158(7):1195-206

Sequences

>TTHERM_00384910(coding)
ATGTCCCTCAAGAACACTAGACCCCCTGTTAAGTCCACCAGAGTCTCTCGTCCTCAATTG
ACTGAAGAATAAAAATAAGAAATTAAGGAAGCCTTCGATCTTTTCGATACCGATGGCACT
GGATATATTGATGCCAAGGAACTTAAGGTAGCAATGAGAGCTTTAGGATTTGAACCTAAA
AAGGAAGAAATCAAGAAAATGATTGCTGAAATCGACAGAGAAGGTCGTGGAGTTATTGAA
TTCTAAGACTTCCTTGATCTCATGACCGTTAAAATGGCTGAAAGAGATCCCAGAGATGAA
ATTTTAAAAGCTTTTAGATTATTTGATGATGATAATACTGGTAAGATCTCCTTAAAGAAT
TTAAAAAGAGTTGCCAGAGAATTGGGTGAAGCTATGACTGAAGAAGAACTCTAAGAAATG
ATTGATGAAGCTGATAGAGATGGTGATGGTGAAATTAGTGAGGAAGAATTCGTTAGAATT
ATGAAAAAGACCAACCTCTTCTGA


>TTHERM_00384910(protein)
MSLKNTRPPVKSTRVSRPQLTEEQKQEIKEAFDLFDTDGTGYIDAKELKVAMRALGFEPK
KEEIKKMIAEIDREGRGVIEFQDFLDLMTVKMAERDPRDEILKAFRLFDDDNTGKISLKN
LKRVARELGEAMTEEELQEMIDEADRDGDGEISEEEFVRIMKKTNLF


>TTHERM_00384910(gene)
ATGTCCCTCAAGAACACTAGACCCCCTGTTAAGTCCACCAGAGTCTCTCGTCCTCAATTG
ACTGAAGAATAAAAATAAGAAATTAAGGAAGCCTTCGATCTTTTCGATACCGATGGCACT
GGATATATTGATGCCAAGGAACTTAAGGTAGCAATGAGAGCTTTAGGATTTGAACCTAAA
AAGGAAGAAATCAAGAAAATGATTGCTGAAATCGACAGAGAAGGTCGTGGAGTTATTGAA
TTCTAAGACTTCCTTGATCTCATGACCGTTAAAATGGTAACTAAAATTTCTTTATTTTAA
TAAATAAGCAGACAGACATACTCATGAACTAGCATTAATAATTTGAATTTAAATAAAATA
GGCTGAAAGAGATCCCAGAGATGAAATTTTAAAAGCTTTTAGATTATTTGATGATGATAA
TACTGGTAAGATCTCCTTAAAGAATTTAAAAAGAGTTGCCAGAGAATTGGGTGAAGCTAT
GACTGAAGAAGAACTCTAAGAAATGATTGATGAAGCTGATAGAGATGGTGATGGTGAAAT
TAGTGAGGAAGAATTCGTTAGAATTATGAAAAAGACCAACCTCTTCTGA