Identifiers and Description

Gene Model Identifier

TTHERM_00760200

Standard Name

CEG1 (Capping Enzyme Guanylyltransferase)

Aliases

PreTt18505 | 125.m00069 | 3672.m00002

Description

Alpha (guanylyltransferase) subunit of the mRNA capping enzyme, (in Yeast the other subunit is CET1, an RNA 5'-triphosphatase) involved in adding the 5' cap to mRNA; the mammalian enzyme is a single bifunctional polypeptide

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01068 ) ATP-dependent DNA ligase domain
  • ( PF01331 ) mRNA capping enzyme, catalytic domain
  • ( PF03919 ) mRNA capping enzyme, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00760200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08901.19.997093137033517e-262hypothetical protein (505 aa)
OxytrichaContig1451.1.g152.000470901975128e-28mRNA capping enzyme, catalytic
domain
SGDYGL130W0.000000000000004001928599951003CEG1 Alpha (guanylyltransferas
e) subunit of the mRNA capping
enzyme, a heterodimer (the ot
her subunit is CET1, an RNA 5-
triphosphatase) involved in ad
ding the 5 cap to mRNA; the ma
mmalian enzyme is a single bif
unctional polypeptide
WormBaseWBGene000004660.00000000002000577768187062locus:cel-1 mRNA-capping enz
yme status:Confirmed UniPr
ot:Q17607 protein_id:CAA9976
5.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00760200(coding)
ATGGGAGATTTTCAAATTCTTTTGCATAGGCCTGGTAATGAAGTCATTATGGGAGAAGAA
TTTAACTACATTTAAGGATACTTGAATGAATTTAAAAAAGAAATGTTGATTGAAAATAAA
ATAACAGATCCAAGAAAAATAGAAAGAATTGATTTTATTGGTGCTTAACCTGTTTCAATG
AGAAATAGTCATGCTGATAGGATAAGAGAAGAAAGAGATTAAGCAGATATTAGCTATATT
GTTTGTGAGAAAACAGATGGTGTAAGATATATAATGGTAATTACAAATAATGGTTATTGC
TACTTAACAGGAAGAAATACCTCTACTGATTCTGAAAATAAATATAAGCTAAACTAAATC
AATGTTTAGTTAAATAAGCAACTATTCATTGATGAAAATGATGATGAAGAGGAGAATTTG
CAAATTTTAGAAATTTTTGATGGAGAATTAGTTTTAGACAAAAAAGGTGACAATTACTAT
TTAAAATATTTAGTTTTTGATTGCTTAGTTCATTTTGGAGAGAAGGTTTCTAATATTGAT
TATTTAAATCGTCTCACAAATGCATTATACTTTGTGCAATACAATAATAGTCTCTATGAG
ATTAATGGAGAGGAACTGCCAAAACCTTAGCCATTTTGTGAATTTAAAGCTAAAGCTCTG
TCTTAATTTTTAGAAACAGGAGAGACTGATAATTTTGAAGATTCAGAAAATGATCTTGTT
ATTTCGATATGTGTTAAAGATTTTTTCAAAATAAAATACTGCAACTACTTATTTGATAAT
TACATACCTTCTCTTCCTCATCACAATGATGGTTTGATTTTCACTAAAAATAACTCAATT
TATAAACCAGGAACTGACGAAAATATAATTAAATGGAAGCCTCCATCAATGAATACAATA
GACTTTCTTCTAGTGGCAAACTAAGACAATATATTATGCGGTATTGACGAAAAAAAAAGC
GATGGAAATTATCTTCTATAATCAAGAGTTATAGATTTATATGTTATGGATAACAATTTG
GAGAGAAAAAATTATGAAATAACATTTTTTGATTTTATGATTGTAGACCCAGACTTTTTC
GAAGAAGTTATTCAAAAAACAAGTGAAAAAGAAGGTGCCAAAGGTGTTGTTGCAGAATGC
AAGTGGATTGATTTGGATTAAGATAAGGGAGAAATAATCAAGAAAATTTATACAAGTGAC
ACTGATAAAATATTAGTTTTACCAGAATTTCCAGATGATAGCAATTAAGATGATAATCGT
AAATGGATAGCTAGCTAAAAATAAACTTATAAAGAGAATAAATTCTCTAAAGGATGGGGT
TTTGATAGATATAGATTAGATAAAAACTTTTCAAATAATAAAAAAATAGCTAAAGATATT
GTTTCTTCAATAAAAGAGAATCTGGATTCTAAGGCTCTTATGCAAAGATTGATGCCTAAT
TAACATCAAAATTCTAACATGGGTAATCCTAATCTTGAACCAAGTATACAAAAAAAATAA
AAAAGATGA


>TTHERM_00760200(protein)
MGDFQILLHRPGNEVIMGEEFNYIQGYLNEFKKEMLIENKITDPRKIERIDFIGAQPVSM
RNSHADRIREERDQADISYIVCEKTDGVRYIMVITNNGYCYLTGRNTSTDSENKYKLNQI
NVQLNKQLFIDENDDEEENLQILEIFDGELVLDKKGDNYYLKYLVFDCLVHFGEKVSNID
YLNRLTNALYFVQYNNSLYEINGEELPKPQPFCEFKAKALSQFLETGETDNFEDSENDLV
ISICVKDFFKIKYCNYLFDNYIPSLPHHNDGLIFTKNNSIYKPGTDENIIKWKPPSMNTI
DFLLVANQDNILCGIDEKKSDGNYLLQSRVIDLYVMDNNLERKNYEITFFDFMIVDPDFF
EEVIQKTSEKEGAKGVVAECKWIDLDQDKGEIIKKIYTSDTDKILVLPEFPDDSNQDDNR
KWIASQKQTYKENKFSKGWGFDRYRLDKNFSNNKKIAKDIVSSIKENLDSKALMQRLMPN
QHQNSNMGNPNLEPSIQKKQKR


>TTHERM_00760200(gene)
ATGGGAGATTTTCAAATTCTTTTGCATAGGCCTGGTAATGAAGTCATTATGGGAGAAGAA
TTTAACTACATTTAAGGATACTTGAATGAATTTAAAAAAGAAATGTTGATTGAAAATAAA
ATAACAGATCCAAGAAAAATAGAAAGAATTGATTTTATTGGTGCTTAACCTGTTTCAATG
AGAAATAGTCATGCTGATAGGATAAGAGAAGAAAGAGATTAAGCAGATATTAGCTATATT
GTTTGTGAGAAAACAGATGGTGTAAGATATATAATGGTAATTACAAATAATGGTTATTGC
TACTTAACAGGAAGAAATACCTCTACTGATTCTGAAAATAAATATAAGCTAAACTAAATC
AATGTTTAGTTAAATAAGCAACTATTCATTGATGAAAATGATGATGAAGAGGAGAATTTG
CAAATTTTAGAAATTTTTGATGGAGAATTAGTTTTAGACAAAAAAGGTGACAATTACTAT
TTAAAATATTTAGTTTTTGATTGCTTAGTTCATTTTGGAGAGAAGGTTTCTAATATTGAT
TATTTAAATCGTCTCACAAATGCATTATACTTTGTGCAATACAATAATAGTCTCTATGAG
ATTAATGGAGAGGAACTGCCAAAACCTTAGCCATTTTGTGAATTTAAAGCTAAAGCTCTG
TCTTAATTTTTAGAAACAGGAGAGACTGATAATTTTGAAGATTCAGAAAATGATCTTGTT
ATTTCGATATGTGTTAAAGATTTTTTCAAAATAAAATACTGCAACTACTTATTTGATAAT
TACATACCTTCTCTTCCTCATCACAATGATGGTTTGATTTTCACTAAAAATAACTCAATT
TATAAACCAGGAACTGACGAAAATATAATTAAATGGAAGCCTCCATCAATGAATACAATA
GACTTTCTTCTAGTGGCAAACTAAGACAATATATTATGCGGTATTGACGAAAAAAAAAGC
GATGGAAATTATCTTCTATAATCAAGAGTTATAGATTTATATGTTATGGATAACAATTTG
GAGAGAAAAAATTATGAAATAACATTTTTTGATTTTATGATTGTAGACCCAGACTTTTTC
GAAGAAGTTATTCAAAAAACAAGTGAAAAAGAAGGTGCCAAAGGTGTTGTTGCAGAATGC
AAGTGGATTGATTTGGATTAAGATAAGGGAGAAATAATCAAGAAAATTTATACAAGTGAC
ACTGATAAAATATTAGTTTTACCAGAATTTCCAGATGATAGCAATTAAGATGATAATCGT
AAATGGATAGCTAGCTAAAAATAAACTTATAAAGAGAATAAATTCTCTAAAGGATGGGGT
TTTGATAGATATAGATTAGATAAAAACTTTTCAAATAATAAAAAAATAGCTAAAGATATT
GTTTCTTCAATAAAAGAGAATCTGGATTCTAAGGCTCTTATGCAAAGATTGATGCCTAAT
TAACATCAAAATTCTAACATGGGTAATCCTAATCTTGAACCAAGTATACAAAAAAAATAA
AAAAGATGA