Identifiers and Description

Gene Model Identifier

TTHERM_00277530

Standard Name

CDT1 (CDT1-like 1)

Aliases

PreTt04794 | 25.m00258 | 3694.m00045

Description

CDT1 DNA replication factor Cdt1; DNA replication factor CDT1; functions as part of DNA replication licensing complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF08839 ) DNA replication factor CDT1 like

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00277530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08913.19.997093137033517e-262hypothetical protein (688 aa)
OxytrichaContig132.1.g1300.0000000010002658722841845DNA replication factor CDT1 li
ke
WormBaseWBGene000013280.00000039992052383199455locus:epi-1 status:Confirmed
UniProt:C1P641 protein_id
:CAX65068.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000290

Sequences

>TTHERM_00277530(coding)
ATGAGTTTAAGACAATAAACATTAACTCAATCCTTGGTTCCAGCTACTAATGAAGTAAGA
AAAGCTCCACAAACTAGAACAAGAGGAGGAGCTAAAAAAGAAATAGAGCTTGCTACTCCA
ATTACTGAATTTGTCAAAGGAAAGGAAACAAGAAAAAAAAATTAAATGATTGATTTGATT
GAAGAAAAGCTTCTTTCAACACTTAAAATGAATTCTTCTGTTGAAAAGGATTCAAGCAAA
ATAATGGATGCTGCTGATTAAATTTAAAAATTAAATCAAAAAGTTGAGCAATCCAATAAA
ATGATTGATGAAAAAGAAGAAATATTTGAACTTCAAACATAAAAGTTGAATTAAGTTGAT
TCAGAAATTGAAATTACTAAATAAGAAGATAAAGCTGAAAGTAAATTTGAATAAATTTTA
TAGACAGTTTAAAATAATGAAAAAGCTCAGAAAATTCTTGCTGGACCATCAATAAAGCAA
AGATATGAGGATTTATTGAAAGGTGATCAACAAGAATTTGCCTTACCCTACAAATACAAG
GTGCTTTTAGAAACTTTTTCAAAGTTTGATGAGTGTATATAATTCTTTAAAGATAGAAAC
AAACCAACTTTATTCAAAGATCTTAAATTTAATCTGGAACAAACTATGCGTGCCACTATC
TCCCTTAAACAGATTTAGTAAATTATTCACTTGTACCCCTAAGCTTACTAGTTAAAGTGG
GTCTAAAATAAATAAGCTCATGAATAATTGGATTTATTAGTTAATTCTGCCTGTGATGAA
AACGATAACAGAGTTGTTTTAACTAAAGCAGATCGTTTATAAAAACTTAGAAATTTACTT
GTTGAAAAGGTTAAATATTTCCATAACTTGTACCTCAAATCTCAAGCTAGAGAGCATTTA
GAGCAAGAGTTGTTAGATAACTTTAGATGGCATGATGATTTCAAGTTATAAGATGTCCCC
AATTTAGAAGAATAGGCTCTACCATTGAAACCTTTCGAAATTAAAGTTGAACCTCTAAAA
GAAACTTTGGAAAAGAATTAAGTAAAAAACGATATATTGGCTCGCTTAATGAAATCAAAG
GCTGAAGAATAAGAAGAAAAAGAAAAACAAAGAAAAGAGCTTATTGAAAAGAGTCTTTAT
ATTTCCACAAAAGAAAATAAGACAGGCTTGAGTGATCGTCTTTACCAGCTTATCAAGGCT
AAAGAAGAAAAAATTAATGAGGAAAAACTTAGATAATCTTTATCTAAAGGAACTGAAATG
CAGAGAAGAATTCCTGAAATCAAAAAAGTTGTTGAAATTATAATGGTTTATTACATCTAA
CGTAAAGTATCAAACATGTTTTATGCCTCTATTGTTGATTATCTCACTTAATCAAGCAAC
ATCATCATATCTAAAAGTTCTGCAATAGAAATGATTGATTATCTCATATAAAACTGCCCC
TTCTGGATAACTCTCATCCCAAATAAATAAGGAAGCATTATTAGAATTGACAAGAGTGTT
GCCCTTTCTAAAATCCTGGCAGAAATTGAAAAAATTGAAAGCTGA


>TTHERM_00277530(protein)
MSLRQQTLTQSLVPATNEVRKAPQTRTRGGAKKEIELATPITEFVKGKETRKKNQMIDLI
EEKLLSTLKMNSSVEKDSSKIMDAADQIQKLNQKVEQSNKMIDEKEEIFELQTQKLNQVD
SEIEITKQEDKAESKFEQILQTVQNNEKAQKILAGPSIKQRYEDLLKGDQQEFALPYKYK
VLLETFSKFDECIQFFKDRNKPTLFKDLKFNLEQTMRATISLKQIQQIIHLYPQAYQLKW
VQNKQAHEQLDLLVNSACDENDNRVVLTKADRLQKLRNLLVEKVKYFHNLYLKSQAREHL
EQELLDNFRWHDDFKLQDVPNLEEQALPLKPFEIKVEPLKETLEKNQVKNDILARLMKSK
AEEQEEKEKQRKELIEKSLYISTKENKTGLSDRLYQLIKAKEEKINEEKLRQSLSKGTEM
QRRIPEIKKVVEIIMVYYIQRKVSNMFYASIVDYLTQSSNIIISKSSAIEMIDYLIQNCP
FWITLIPNKQGSIIRIDKSVALSKILAEIEKIES


>TTHERM_00277530(gene)
ATGAGTTTAAGACAATAAACATTAACTCAATCCTTGGTTCCAGCTACTAATGAAGTAAGA
AAAGCTCCACAAACTAGAACAAGAGGAGGAGCTAAAAAAGAAATAGAGCTTGCTACTCCA
ATTACTGAATTTGTCAAAGGAAAGGAAACAAGAAAAAAAAATTAAATGGTAAAAACTCTA
AAATTGATGATTATTATGATATCCATGGAAATGACAAAACCTTTATCTCGCATGATATTG
ATAATGAAAAAGATCATAACCAATCAAGCATATCAACTGCCTCAACAAATACAACAATAG
ATTATGAAAGAATTAATCATTTAAAGAGTATCAAATTAGCTTCTGATTTTAGTTAAATTC
CTTCTGGAAACACTATAACTATTGGAGGAAATTCTAATATTATGTAAGTCGAAGATAAGC
CTTTGCAAATAGATATTTAAGCAAATTAAAAACCTGCTATCGACTTTAAACAATTTTTAG
ATGAGTAACAAAAGCAAAAACTCAAAAAAGAAGAAGAATTGGAGTAATAAAAATAACAAC
AGCAGTAAAAAAATGCTAAACTACTCTAAAATTTTGAGAATTTAAAAAAGAAATCTGCAT
TGTCTAATAGCACTACAGATTTAATATCAAAAATTTTAAACAAAAATAAAACTTAATAAG
ACAAACCCGATAATATTTAAAATTTCAATAATCTTTCTTCTGCCAAAAAGATTGATTTGA
TTGAAGAAAAGCTTCTTTCAACACTTAAAATGAATTCTTCTGTTGAAAAGGATTCAAGCA
AAATAATGGATGCTGCTGATTAAATTTAAAAATTAAATCAAAAAGTTGAGCAATCCAATA
AAATGATTGATGAAAAAGAAGAAATATTTGAACTTCAAACATAAAAGTTGAATTAAGTTG
ATTCAGAAATTGAAATTACTAAATAAGAAGATAAAGCTGAAAGTAAATTTGAATAAATTT
TATAGACAGTTTAAAATAATGAAAAAGCTCAGAAAATTCTTGCTGGACCATCAATAAAGC
AAAGATATGAGGATTTATTGAAAGGTGATCAACAAGAATTTGCCTTACCCTACAAATACA
AGGTGCTTTTAGAAACTTTTTCAAAGTTTGATGAGTGTATATAATTCTTTAAAGATAGAA
ACAAACCAACTTTATTCAAAGATCTTAAATTTAATCTGGAACAAACTATGCGTGCCACTA
TCTCCCTTAAACAGATTTAGTAAATTATTCACTTGTACCCCTAAGCTTACTAGTTAAAGT
GGGTCTAAAATAAATAAGCTCATGAATAATTGGATTTATTAGTTAATTCTGCCTGTGATG
AAAACGATAACAGAGTTGTTTTAACTAAAGCAGATCGTTTATAAAAACTTAGAAATTTAC
TTGTTGAAAAGGTTAAATATTTCCATAACTTGTACCTCAAATCTCAAGCTAGAGAGCATT
TAGAGCAAGAGTTGTTAGATAACTTTAGATGGCATGATGATTTCAAGTTATAAGATGTCC
CCAATTTAGAAGAATAGGCTCTACCATTGAAACCTTTCGAAATTAAAGTTGAACCTCTAA
AAGAAACTTTGGAAAAGAATTAAGTAAAAAACGATATATTGGCTCGCTTAATGAAATCAA
AGGCTGAAGAATAAGAAGAAAAAGAAAAACAAAGAAAAGAGCTTATTGAAAAGAGTCTTT
ATATTTCCACAAAAGAAAATAAGACAGGCTTGAGTGATCGTCTTTACCAGCTTATCAAGG
CTAAAGAAGAAAAAATTAATGAGGAAAAACTTAGATAATCTTTATCTAAAGGAACTGAAA
TGCAGAGAAGAATTCCTGAAATCAAAAAAGTTGTTGAAATTATAATGGTTTATTACATCT
AACGTAAAGTATCAAACATGTTTTATGCCTCTATTGTTGATTATCTCACTTAATCAAGCA
ACATCATCATATCTAAAAGTTCTGCAATAGAAATGATTGATTATCTCATATAAAACTGCC
CCTTCTGGATAACTCTCATCCCAAATAAATAAGGAAGCATTATTAGAATTGACAAGAGTG
TTGCCCTTTCTAAAATCCTGGCAGAAATTGAAAAAATTGAAAGCTGA