Identifiers and Description

Gene Model Identifier

TTHERM_00133750

Standard Name

CDK7 (Cyclin Dependent Kinase 7)

Aliases

PreTt24298 | 10.m00347 | 3698.m00069

Description

Cyclin dependent kinase protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00133750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05739.19.997093137033517e-262hypothetical protein (369 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000270

Sequences

>TTHERM_00133750(coding)
ATGGAATCTAAAACTGATATTAAAAAACATTTAAAACTTCATTACGATATCATCGCAAAC
AAAATTTTGAAAACTGATTTAAACACCCATAAACCTCCTTTTATACCATTTACTTTTTCA
GAATGGAGACGTGATGCATTCAATTCACTTGAAATTGAATTAGAGAAATTATCTTTTGCA
GAAAAGCAAGATTCCAAAAGAGAGTTTATAAATATGGTTGATGGGGATTTGCTTTATTCA
TTCCAAAAGAAGATGAAACAGCCTTATTTTGAACTTGTTTTTTATGATAATTATGCTATT
CCAAAAGGATTGGATTTCTAAGCTGCAAGAAAAGATTATCATTTATTCAAAGACTTAGAA
GCTTTGGCCAACCAAATATCTGAATGGTGCATACAAATAGAAATCAGTGCTGATTTAGTT
GATAGAGCAGAACTTTATAACTACTTTTCATGCGAAAAAGAAGAAAAATAAATTTACAAA
GATTTAAAGGAACAATTATAAGCAAGCTCTAGTAGCAGTGTAGGAGAAAAAATTAGAAAG
TTTTTCAAGAGCACGCTATCCTATAGCATAAAGAGCCTCAGTAACATAGTTTGGACTAAA
GGAATAGCTCTTTCAAATATATCTATGGGAGCTCTCATCTTACTATATTACTCTTTTATT
GGTACTTCTTCTTTACCAGTGCAAATTTTGATGCCTAGAATGCATATATCTTGGCTAGTA
GGAGGTATTGTAGGATCTTACGCTTTAAATAAAGTCGCTGACTCTATAGAACGTGGTGAA
GTAGCAAATAATCTAACTAAAATAACTGAAATATTCAGAGAGATTACTCTAAATTTGATT
GAATTTAATGACAATTGTGAGTATTCTATTAAAGATTGCACACTCTAGAAAACTGAAGAC
GATTTATAGACTAAGTGTTTATAATTGAAGAAAGTTATTAGACACCTGTTGGATAATGCT
GAGAAGTTGACCGAAATGAAAGAAAGAGTTTCTAAACTAAGACATTTAATTGAAAAAGAT
GACGACGAAGACGATGATCTGGTATTAATTGAGCTTGAAGATGTTTAAAAAGAAGATAAT
AAAGAGAAAGCTAAATCAGATTGA


>TTHERM_00133750(protein)
MESKTDIKKHLKLHYDIIANKILKTDLNTHKPPFIPFTFSEWRRDAFNSLEIELEKLSFA
EKQDSKREFINMVDGDLLYSFQKKMKQPYFELVFYDNYAIPKGLDFQAARKDYHLFKDLE
ALANQISEWCIQIEISADLVDRAELYNYFSCEKEEKQIYKDLKEQLQASSSSSVGEKIRK
FFKSTLSYSIKSLSNIVWTKGIALSNISMGALILLYYSFIGTSSLPVQILMPRMHISWLV
GGIVGSYALNKVADSIERGEVANNLTKITEIFREITLNLIEFNDNCEYSIKDCTLQKTED
DLQTKCLQLKKVIRHLLDNAEKLTEMKERVSKLRHLIEKDDDEDDDLVLIELEDVQKEDN
KEKAKSD


>TTHERM_00133750(gene)
ATGGAATCTAAAACTGATATTAAAAAACATTTAAAACTTCATTACGATATCATCGCAAAC
AAAATTTTGAAAACTGATTTAAACACCCATAAACCTCCTTTTATACCATTTACTTTTTCA
GAATGGAGACGTGATGCATTCAATTCACTTGAAATTGAATTAGAGAAATTATCTTTTGCA
GAAAAGCAAGATTCCAAAAGAGAGTTTATAAATATGGTTGATGGGGATTTGCTTTATTCA
TTCCAAAAGAAGATGAAACAGCCTTATTTTGAACTTGTTTTTTATGATAATTATGCTATT
CCAAAAGGATTGGATTTCTAAGCTGCAAGAAAAGATTATCATTTATGTAAAAATTTTAAA
TTGCATTTTGTTAATATTAACATTTTAAAGTTTTCAAGTTTTAAACCATCAAACCTACTA
AAAAATAAATTTAAAAACCAATAGTCAAAGACTTAGAAGCTTTGGCCAACCAAATATCTG
AATGGTGCATACAAATAGAAATCAGTGCTGATTTAGTTGATAGAGCAGAACTTTATAACT
ACTTTTCATGCGAAAAAGAAGAAAAATAAATTTACAAAGATTTAAAGGAACAATTATAAG
CAAGCTCTAGTAGCAGTGTAGGAGAAAAAATTAGAAAGTTTTTCAAGAGCACGCTATCCT
ATAGCATAAAGAGCCTCAGTAACATAGTTTGGACTAAAGGAATAGCTCTTTCAAATATAT
CTATGGGAGCTCTCATCTTACTATATTACTCTTTTATTGGTACTTCTTCTTTACCAGTGC
AAATTTTGATGCCTAGAATGCATATATCTTGGCTAGTAAAATTATATAAATATTATTTAT
TTGAGAGTTATAATTTAAATTTTTTTATAAGGTAGGAGGTATTGTAGGATCTTACGCTTT
AAATAAAGTCGCTGACTCTATAGAACGTGGTGAAGTAGCAAATAATCTAACTAAAATAAC
TGAAATATTCAGAGAGATTACTCTAAATTTGATTGAATTTAATGACAATTGTGAGTATTC
TATTAAAGATTGCACACTCTAGAAAACTGAAGACGATTTATAGACTAAGTGTTTATGTAT
TAAAGAATTTATATTCTAGCATATTTATTTTTATTACAAAAATTGCAAAAATTTAAATGA
AAAAATAATTTATTTAATTTCTTTAAAATAAATTTTTTAAAAATTATTAGAATTGAAGAA
AGTTATTAGACACCTGTTGGATAATGCTGAGAAGTTGACCGAAATGAAAGAAAGAGTTTC
TAAACTAAGACATTTAATTGAAAAAGATGACGACGAAGACGATGATCTGGTATTAATTGA
GCTTGAAGATGTTTAAAAAGAAGATAATAAAGAGAAAGCTAAATCAGATTGA