Identifiers and Description

Gene Model Identifier

TTHERM_01080600

Standard Name

CDK5 (Cyclin-Dependent Kinase)

Aliases

PreTt02102 | 222.m00058 | 3798.m00215 | MicNup98A

Description

cyclin-dependent kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01080600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20238.12.000724368835138e-100hypothetical protein (381 aa)
OxytrichaContig19821.0.0.g580.0000000000002999981760818895Nucleoporin autopeptidase
SGDYGL092W0.00000000039982266684865623NUP145 Essential nucleoporin,
subunit of the Nup84p subcompl
ex; catalyzes its own cleavage
in vivo to generate a C-termi
nal fragment that assembles in
to the Nup84p subcomplex of th
e nuclear pore complex, and an
N-terminal fragment of unknow
n function that is homologous
to Nup100p; the Nup84 subcompl
ex has a role in transcription
elongation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_01080600(coding)
ATGAGGATTCATAGTATAAATAAGTATTACAAAAAAATGGATTATTTTTAATACTAAGAA
TAAGATCCAATTAAATAAGAATATAAAATATAATGTAAAGTAGCAGAGGGAGCATTTGGT
TCTGTTTTTAAAGCAATCAAATAAAATACGCAATAAATAGTTGCTATTAAAGATTTATTT
TTTAATCAGAATAAAAGATCTAAGTAGATTGTTGAAAGAGAGGTGTCCATTATGTAGGAT
TTAAATGATCATCCAAATATAGTAAAATTAATAGATTATTAGATATCTAACAACAAATGC
TCTCTTGTGATGGAATACATTGATTATGACTTAAAATAATTTATAGAAAGCTAAGTTTAT
CCTCTTAGTCATTCAAAAATAAAAAGAATAGCCTTTTAATTACTCACTGGATTATCATTT
ATTCACTCGAAGGGCATTATTCATAGAGATTTAAAACCATCAAATATATTAATTACTAAC
TAATTTATTGTTAAAATTGGTGATTTTGGATCAGCTATTAAAGAAGAGTAAAGAAAGGAT
AAATAATTTTCTATTGAGGGATTCACAAGATGGTATAAGTCTCCAGAGTAGCTTTTTGGA
TCTAGGGAGTATAATTACGAAATAGATATTTGGAGTTTTGCATGCATTTATGCTGAAATA
ATATAAGGATATCCTTTATTTTCTGGTAATAATGAAATAGAATAAATTGCTAAAATATCT
GATTTGCTTGGTAATCCATGTGAAGAAAATTGGCCTAGTATTGTTAAGATGCCAGATTAT
GGAAAAATTTTATTTAAACAAAAATAAAAAAAAAATTTGAGCACTTTATTTAGTTAAGCT
TCTGAAAAAGAAATAGAGTTTCTAAATTCAATGTTAAAATATGATAATAGACCTACTGCT
GAATAATTATTGCAGAGTGAATATTTTAAAGATGACTCTGTACCATTAAAATTATAAAAC
AAAAGTATAATTTTGCCTCCTAAGCATGAAGATAAGATATATTTTAATTATACTAGCGTG
CTAAAAAAATGA


>TTHERM_01080600(protein)
MRIHSINKYYKKMDYFQYQEQDPIKQEYKIQCKVAEGAFGSVFKAIKQNTQQIVAIKDLF
FNQNKRSKQIVEREVSIMQDLNDHPNIVKLIDYQISNNKCSLVMEYIDYDLKQFIESQVY
PLSHSKIKRIAFQLLTGLSFIHSKGIIHRDLKPSNILITNQFIVKIGDFGSAIKEEQRKD
KQFSIEGFTRWYKSPEQLFGSREYNYEIDIWSFACIYAEIIQGYPLFSGNNEIEQIAKIS
DLLGNPCEENWPSIVKMPDYGKILFKQKQKKNLSTLFSQASEKEIEFLNSMLKYDNRPTA
EQLLQSEYFKDDSVPLKLQNKSIILPPKHEDKIYFNYTSVLKK


>TTHERM_01080600(gene)
ATGAGGATTCATAGTATAAATAAGTATTACAAAAAAGTTAAAAATTTTTTATCAATAAAG
ATATTCTAATTAAGATTTGAATTTTGTATTAACTATACATTATCGTAGAGTAAGATTTTT
ATCATTTTAATATTTTTAGAGAAAGATATTTTCACAATATATTTAAATTAAAAACTTTTT
TGTATTATTTAAAGCTATTTGATAAATTTTTTTCATATATTATCCATTCTATTAAGACTT
ATTTTTAAAAATGATTCTTTGGTATTTACTTTTAATAATCAAAAACTATAAAAACTTAAA
AATGATTTAATGAAACAATTTTAAATAAGTTAATATATTTGTGGACAATTAATAATATTT
ATATTTATAATTAAATTATTCAACTTAAAAAATAAAAGATGTAAATAACTATATCATGAT
TACTTATTCAAGATCACTGAGAATAGACAATTCAAAATTTAAAAATTTTTAATTGAAACA
AAAGAATTAATTGGCTATTTAATTATATTACAATCCTACTAATATCTATTTCTTAAATTA
TATAAATCAAATTATTTTTTTGTTTACAATAATAAAAACGATAGAAAAAGATACAAATAA
TACTTTTTAAGTAAAAAAAAAAGAGAATAAATATAATCGGTGGCTTGCTTGCTTTTTTTA
TTTATTAGTGTACATTTAAGAATTTAAATTTTTTCATACAACCAAGAGGTTATTATGATT
TTTGATACTAGTACTTATTGCATGAATGTATAAAAAAGATTGGGAAAAAATTTAGTTAAA
AATTCTAAATTTTATTTTTGAGTAATTTATGATGAATTTATTTAATAATAAAGAAATTTC
AATAGTTTTATTAATAATCTCTGATTCTATTTCCTTTATCTTATTGATATTATTATTATT
ATTATATCTAGCTATTATGACTTATCACTTCTTGTTAATATCCAAATACTATTTCACTCA
ATAAAACTATTTGGTCATATCTATTCTATTCCTTTTCTTAAAACTAAGTTTGGATGAAAG
TTCTATTGAAAACAATTTATTTATTTATTTCTTATTGGGAATTGAATTCTTCATAGTAAG
CTTTTGAAAAATTAATAAATAAAATTCGATTATTTTATTCTTCTGTGAGGCGTGACTCAT
CTATTATTATTTCTTTCAAGAATCCTTTGGTTGGATTACTTAAGACATTTATTAGATTAA
TTATAGATGTAAAATTGCATTTGAAGTAATCAAAATCTCCTTCCATTACATTATTACTCA
ATTAAAATAATTCATTTCCTATTGTTTCCTATAATTTTACTGGTTTTATATTATTATTTA
TTGCGAATTCGTATAAGTCTTTTTTATATTATAATTGCATTTTTTGCTTGCAGAATTTTG
TGATTTGTAGTATTTCAACTTAATTTTTGAATTTAAAAGTAAATTAATGGTTGTAAAGTA
GAGCTATTAGTATGTCTATATTTTTTAAAACAGTTGAAAGAAGTTACTAGTTGGCTCCTT
TATTACCTGCAGGGAATTTAGGGTCATTATAAAAAGTGGATAAGGTATCTCTACATTTTT
TTATTTCTATGTAAAAAGTATCTACATGATAATTAACGAAATCTCTTAAAAGTAAACCAA
ATTCTAACGCAAATTCTGGGTCTAGATGCTACTCTTCGATAAGAACAAAATTAGAATAGT
CTTTTGATACTTTTTAAATGTAAGGCTCACCTTAGGATATACACTCAGCAAACCACTCAT
GGTTGAACATTTCATGCCAGCTAATACGTTTTTTAGGGTTGAGAGTTAACATTTAATCTA
TTAGATTTTATGCACTCTAAGAAATATTCTACCTAAAAATAAGCTATCTTTAATTTATCA
GTCTTTTGAGTTCTTCAATACCTCCATTATTCGTAGGCAAAAAAGGAGCACGGCCTTCAA
GCATTTCATAGATCATACAGCCTACAGACCAAACATCACATCTGCTATCATATCCTAGAT
TATTTAATACTTCTGGAGCCATAGTCATAGGAGTACCAACCTAATCTTTATCTTTTTCAA
AGCTGGATTTGGCTAGGCCAAAGTCAGCAACTTTTAAGTGAAAATCTTTTGTAATTAATA
CATTGGCTAGTTTCATATCACGATGTATGATATTCATATCTGCTATACCTAAGAAAGCCA
AGAGTATTTAATATGCGAAAACTTTGACTAATTCTTCAGGCAATCTAAGTTTGGTAGCCG
AAAAATTATTTTTGATGAAAACTTCCAAATCACCCAATTCGCACAACTCAGTAACAATAT
AAATATAATCTCCTTCGTTGAAGAGATCTAAAAACTTAATTATATGCTCATTATTAAGTT
AAGAAAGCACTGATATCTCACTATCAATTAATTCTAAATACTGCTTATCAAATTTATTCT
TGTCAATCTTTTTTATAGCAACTTTTTCACCTGTTTCACTATTTATGCCTTTAAATACCT
TAGCAAATGAACCTTTACCAATTTCATTTGCCATTATGTATTTTGTTTTCAGAAGTCTCT
TAAACCCTTCCGAGCTTATTGTTTTCTAGCTAAAAGCTTATTATCTTTATTGTTATTATT
AAATCTATTATTAGTTTACTGTTGGTTGCTGGTAATATTATCTTTGCTGATAATTCTAGC
TACTTGGTTATTGATTCATGCTTATATACCTATTTTATTGGCCAGGAACATTGTTGATTC
CTTGGTAATTGTAAGCATTATGTTATGTAATTGGTACTCTATTTATTGTATTATTATTAT
AGTATTATTATTAATTGCTATAAGGAGGGTTATTATATCTTTAATCCATTTTTTTTACAA
TAAATATTAAGTGAATCTATTTTTTTAAGTATTCTAAAGAAAAATTGTTTGCTTCTCTTA
CTTCTTTGGGTGTTACTTGAGGCTGTTTTAAGCAAAACTTTAAATTTTCTTTTCTTTTTT
ATAAAGTTTTTAATTTATTTATCAATTTATTAATTACTAACCTCTATATAAATAATATTT
TTTAAAAGGGTGTTTCTTGATTTTCTCTTTAAATATGAAGTAATGTTATAAAATTAATCT
GATTATTAATATTTCTAATTCTTTTATCAGAATAAAAAAGGCCCTAAAAAATTTACCTAT
TATAAAGGAGACGCATAGGAGAGACCTGAACCTATTTTGACTGGTTTAAGAAAATACTTT
TAAAATAGTTAATCCTAGAGCAAATTTTTTTGTGCCATTATCAGAGAAAACAAAAGATTG
AGATAAGATAGTACAAATCAATATCACTGTTTGTTTACTTATTTACTGGTTTATATTGTA
AGTATAATTTTTTTAATGTATATCAATATGCCTTTTAGATTTTAATTTTTAGATGTAAAA
ATTGAAGTAAAAGTTGAAATATAAATAATTATTGAATAATTAAAATAGATATTAGAAAAA
GCATGAATTATAAGATATTAATGAGTTATAAAAATATAAACATTTAAATACTATAGACTT
AATAAATATATTTACGCAAAATTAATTAAAGGAAAATCTATATTAATTAATTATCAAAAA
TTTCTTTCTTTTTTATACATATAATTAATTAACTTTTATATAAAAAATATATTTAATAAA
TTAATTATTTTAATCAACAACTCCAGTCAAATACTCTAAAACTGAACCAGAATTTTTTTC
TATCAAAATTTACATACTCACATTTGTTCTTTTCACACTGTTTTTTAAGTTTTCTTTCCA
ATTTCTCATAGTCAATAGTTTTTTATCTGTGTTCCTCAAATGCTTTTTTATCAATGCAAT
ACAATGTTACAACAGCCTGTTAGTTTAATTTACATCCAACCTTAGGGCATTTACCAGAAT
ATAAGTGCTCAGGATAAACAATAGCCCTTTGTTATTCTATTATAACTATTTTATCTAGAT
CCTGTCTAGTTATCTCTACTGGATTTTCAAATTCTATTTTCCCGTATTGGTTCTAAATAA
TAAACTAGTTGACACTTTATAATTCTTCTATTGGCCAATGTCTCATTTCATATACAGAAG
GTGAGCATTTATACTTATCATTCTTTAGTACAGGCGCCTCACTAACAAAAATTTCTATAA
TTATTTTACCTTTATTAGTTACTTTAAAGTCCTTGAGCGATTTTTCAATAGGTGTCAAAG
CCACTATTTTCCCATCAGTGTCAATATATGTAGCATTTTTACCTATAAGTTCATCATAAT
CTCTATGCCAAATCAATCCACTTTTTAAAATGTGTTTTTAATAGTGGTCAGAAATAATTT
ATTAAATAGTGTCTGTTAACTTAAATTAAACCTTTTATAATTAATCAATTTCTTCACTTT
TTTGTGTGGAGATATTAGTCACATGGCAAATAACAGACACAAAAGCAAACTCTCTCTTCA
TTTCATATTTGAAAAGTCCAAATCCAAACTTTTCATATTTTCTTTATTTTGCAAGTTCTT
CTTTCCATTTCTCCAAATCGAGTAGCTTTTTTGTACACTTAGCTAAAATGTTTAAATCCA
TAAGGCCCTCATTATGAGAATCTAGATATTCCCTATAAAATTGTCTCTCTTATTCAACTT
CTTCTTCTGTTTCAAACTCTTCAATATGTTTACGATCTTTATCAAAAGGATGATTGCCAT
TTTCTTAAGCTTCTTACTATAACTAAATCCCTCTCTGTCTCATCTATTCTTCCATTAAAG
CTTTTCTTCTAGGTAAGTAAAATTCACTATTTGGATCTTACTCCATTTCATAGAGAAATT
GGTATTTCTTTTTAACGTTTTATTCTTACTTATTCAAACTCTATCTTTTTAAATCATTCC
ATAATCTGTTTTAATTATACAAACCAGGAAATAACTCCTTGATTTATTATTTTTTCTTTT
TTTCATCTTCCATATTTAGCAGGCTATTATTTAAATTATGAATGCTCTTTTGTTCTGCTG
CATTCCCACTATTACTTTACTGTAAATCCTCACTATTTCTTCTTAGATTAATAATCATAT
TTGAATTCTTGAGTATTCCTGTAGGTTTTTTTTCAGAAAAGAAACTTTTGGTACTTTATG
GTCGAATAAGTCTATCATTTAAAAATTATTTCTAATCTTAAGTCAAATCTCCTTTTTAAT
CTAGAATAATTTAAAATTTAATTATTATTGAAAATTAATTTTAAATAGCTAAGGTTGTTT
TAATAAAAGGAGAGCATATGTACTAAATTTCTTGAATAATAATAAGTTCATAAAATTTAA
TCAAAAAGATATTTTACCTATAAATGTATTAGCGACTCTCTTAACTTGTAGTCTCTTTGG
TGGAGGTAGTACTAGCTTATTATTAAATTATGGGATTAGATTATTCCCCTAACCATAATA
AGGTTAATTATTTGTCCTAAATGGACTCATATTGGCCAATCTAATCTTCGGAGTATATTT
AAGAAGTGAATTTTAAGTATCAAAAATGCTTGTTGGGGGCATGTAATTTATAACTTCCAA
TAGATTAGGTGCATTACCAAATATACTCTAAGTTTAATTTGGTTAATTTAAGATGCTATT
TGGCTAGTTAAATACATTTTAGATAGTATTATTATTGTTGTTGTTATTAAATATACTCTA
ATTGTTTGATCTATTTACATTTAAGTTGTTATTCATACTATTATTAAAAATACTTTAATT
ATTGCTATTATTAAAAATACTTGAATTATTATTTAATATACTTTAATTTGTATTATTAAA
AATACTTGAGTTGTTGTTGTTATTGTTATTACTGCTAAAAATATTCTAATTATTATTACT
AGATTTAAAAATATTATTGTTATTATTATTATTGTTGTTATTAAAAATACTTTAATTATT
ATTATTGTTTTTGCTAAATATATTTTAGTTGTTGCCATTATTGTTATTATTAAATATACT
TGAGTTGTTATTGTTAAAATTACTTTAATTATTGTTATTATTGTTGTTTTTAAAGATATT
TTGGCTATTGTTCGTATTGTTGAAGACATTTTGATTATTGTTACTATTGCTAAAAATATT
CAAATTATTATTTGTGTTGTTGTTATTATTATTAAAAATGCTTTAATTTTGATTGTTAAA
ATTTCTTTAAGTATTATTATTACCATTAAAGATACTTTGATTGTTTATGTTCTAATTGTT
GTAATAACCTTAAGTATTTTATCCAAAATTTGCAGTTTAATTACTATTATTGTAGTACAT
GTTGTTATTATTCACTTAATTTTAGTTGAAAATAGGATTAGCATTATTGTAGCTTGCGTA
CATATTTCTATTCATTTAGTTGTTTTAATTTCCACTGCCTCCTACTGGATTACTTGTTTA
CCTATTCATTCTACTTGCAACTATAGGATTTATGGGATTGCTGTTCATTACATTTTAATT
ATTAGATTAAAATATATTTTAATTTGGGATCTATTAAACACTTCTATTCATATTATTATT
GTATACACCATTTGCTAAATAATTCATCTAATTTTAATTTTGATACTACTGTTCAGTCAT
ATATTGTGGGTTATTATATGGATTCATATTTTAAGGATATCCATATTGCTATTAACTGTT
GCTCATATAAGGATTATATACATTTTAGTAGCCATACATTTACATCTGAATTAGGCCGTT
GTTTCCTAATTTTTGCTATAAATATTATTAAACAAAGATATTATTTATTTACCTTATTTA
CTTTATTTTTTAAATTAAAATTTCAAATTATTAAATATTTTATATCAAAAATAAACTAAA
TCCGCCAATTTTCTATTAAAAGTAAAAGGTAATTAAATTTGAGGCACTACATTCATGATA
AATTGAAATTATAAAATAGATAAGATGGATTATTTTTAATACTAAGAATAAGATCCAATT
AAATAAGAATATAAAATATAATGTAAAGTAGCAGAGGGAGCATTTGGTTCTGTTTTTAAA
GCAATCAAATAAAATACGCGTAGATTTTTATGAATATTTGTTGATGATTAGTTTGTTAAA
AATATTTTTATAGAATAAATAGTTGCTATTAAAGATTTATTTTTTAATCAGAATAAAAGA
TCTAAGTAGATTGTTGAAAGAGAGGTGTCCATTATGTAGGATTTAAATGATCATCCAAAT
GTAAATTTACTCATATTGGAAATGAAAATTCTTATTAAAATGAAATGAGTAGATAGTAAA
ATTAATAGATTATTAGATATCTAACAACAAATGCTCTCTTGTGATGGAATACATTGATTA
TGACTTAAAATAATTTATAGAAAGCTAAGTTTATCCTCTTAGTCATTCAAAAGTAAAATA
AAACAATAATCAATAATGAAAATAATTTGACTAGTTTTTCTAAGATAAAAAGAATAGCCT
TTTAATTACTCACTGGATTATCATTTATTCACTCGAAGGGCATTATTCATAGAGTAAAAA
ATTTCATTATAAATAAATAGTATAAGAATTTGATTTTTTTAAAAAGGATTTAAAACCATC
AAATATATTAATTACTAACTAATTTATTGTTAAAATTGGTGATTTTGGATCAGCTATTAA
AGAAGAGTAAAGAAAGGATAAATAATTTTCTATTGAGGGATTCACAAGATGGTATAAGTC
TCCAGAGTAGCTTTTTGGATCTAGGGAGTATAATTACGAAATAGATATTTGGAGTTTTGC
ATGCATTTATGCTGAAATAATATAAGGATATCCTTTATTTTCTGGTAAAAAAACTTCTAT
GTAAATTAATTAATAAATAAAATTTGAATAATAAAGGTAATAATGAAATAGAATAAATTG
CTAAAATATCTGATTTGCTTGGTAATCCATGTGAAGAAAATTGGCCTAGTATTGTTAAGA
TGCCAGATTATGGAAAAATTTTATTTAAACAAAAATAAAAAAAAAATTTGAGCACTTTAT
TTAGTTAAGCTTCTGAAAAAGAAATAGAGTTTCTAAATTCAATGTTAAAATATGATAATA
GACCTACTGCTGAATAAGTAAATAGTTTAACATAAATAAAAATTAAATTAATTTTGCTTA
CATAAATATAGTTATTGCAGAGTGAATATTTTAAAGATGACTCTGTACCATTAAAATTAT
AAAACAAAAGTATAATTTTGCCTCCTAAGCATGAAGATAAGATATATTTTAATTATACTA
GCGTGCTAAAAAAATGA