Identifiers and Description

Gene Model Identifier

TTHERM_01080590

Standard Name

CDK5 (Cyclin-Dependent Kinase 5)

Aliases

PreTt02101 | 222.m00057 | 3798.m00214

Description

Protein kinase domain containing protein; sequence similarity to the CDK protein kinase family; possibly involved in macronuclear synthesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01080590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20239.19.997093137033517e-262protein kinase domain-containi
ng protein (333 aa)
DictyBaseDDB_G02886771.0002758036576784e-62cdk5 on chromosome: 5 position
1885785 to 1886770
WormBaseWBGene000103491.9999167998962255e-60locus:dyf-18 status:Partiall
y_confirmed UniProt:O17903
protein_id:CAB07422.2
SGDYPL031C1.999576471039937e-58PHO85 Cyclin-dependent kinase,
with ten cyclin partners; inv
olved in regulating the cellul
ar response to nutrient levels
and environmental conditions
and progression through the ce
ll cycle
OxytrichaContig5189.0.g912.9987037581344066e-55Protein kinase domain
Stentor CoeruleusSteCoe_320912.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000256

Sequences

>TTHERM_01080590(coding)
ATGGATTATTTTTAATACTAAGAATAAGATCCAATTAAATAAGAATATAAAATATAATGT
AAAGTAGCAGAGGGAGCATTTGGTTCTGTTTTTAAAGCAATCAAATAAAATACGCAATAA
ATAGTTGCTATTAAAGATTTATTTTTTAATCAGAATAAAAGATCTAAGTAGATTGTTGAA
AGAGAGGTGTCCATTATGTAGGATTTAAATGATCATCCAAATATAGTAAAATTAATAGAT
TATTAGATATCTAACAACAAATGCTCTCTTGTGATGGAATACATTGATTATGACTTAAAA
TAATTTATAGAAAGCTAAGTTTATCCTCTTAGTCATTCAAAAATAAAAAGAATAGCCTTT
TAATTACTCACTGGATTATCATTTATTCACTCGAAGGGCATTATTCATAGAGATTTAAAA
CCATCAAATATATTAATTACTAACTAATTTATTGTTAAAATTGGTGATTTTGGATCAGCT
ATTAAAGAAGAGTAAAGAAAGGATAAATAATTTTCTATTGAGGGATTCACAAGATGGTAT
AAGTCTCCAGAGTAGCTTTTTGGATCTAGGGAGTATAATTACGAAATAGATATTTGGAGT
TTTGCATGCATTTATGCTGAAATAATATAAGGATATCCTTTATTTTCTGGTAATAATGAA
ATAGAATAAATTGCTAAAATATCTGATTTGCTTGGTAATCCATGTGAAGAAAATTGGCCT
AGTATTGTTAAGATGCCAGATTATGGAAAAATTTTATTTAAACAAAAATAAAAAAAAAAT
TTGAGCACTTTATTTAGTTAAGCTTCTGAAAAAGAAATAGAGTTTCTAAATTCAATGTTA
AAATATGATAATAGACCTACTGCTGAATAATTATTGCAGAGTGAATATTTTAAAGATGAC
TCTGTACCATTAAAATTATAAAACAAAAGTATAATTTTGCCTCCTAAGCATGAAGATAAG
ATATATTTTAATTATACTAGCGTGCTAAAAAAATGA


>TTHERM_01080590(protein)
MDYFQYQEQDPIKQEYKIQCKVAEGAFGSVFKAIKQNTQQIVAIKDLFFNQNKRSKQIVE
REVSIMQDLNDHPNIVKLIDYQISNNKCSLVMEYIDYDLKQFIESQVYPLSHSKIKRIAF
QLLTGLSFIHSKGIIHRDLKPSNILITNQFIVKIGDFGSAIKEEQRKDKQFSIEGFTRWY
KSPEQLFGSREYNYEIDIWSFACIYAEIIQGYPLFSGNNEIEQIAKISDLLGNPCEENWP
SIVKMPDYGKILFKQKQKKNLSTLFSQASEKEIEFLNSMLKYDNRPTAEQLLQSEYFKDD
SVPLKLQNKSIILPPKHEDKIYFNYTSVLKK


>TTHERM_01080590(gene)
ATGGATTATTTTTAATACTAAGAATAAGATCCAATTAAATAAGAATATAAAATATAATGT
AAAGTAGCAGAGGGAGCATTTGGTTCTGTTTTTAAAGCAATCAAATAAAATACGCGTAGA
TTTTTATGAATATTTGTTGATGATTAGTTTGTTAAAAATATTTTTATAGAATAAATAGTT
GCTATTAAAGATTTATTTTTTAATCAGAATAAAAGATCTAAGTAGATTGTTGAAAGAGAG
GTGTCCATTATGTAGGATTTAAATGATCATCCAAATGTAAATTTACTCATATTGGAAATG
AAAATTCTTATTAAAATGAAATGAGTAGATAGTAAAATTAATAGATTATTAGATATCTAA
CAACAAATGCTCTCTTGTGATGGAATACATTGATTATGACTTAAAATAATTTATAGAAAG
CTAAGTTTATCCTCTTAGTCATTCAAAAGTAAAATAAAACAATAATCAATAATGAAAATA
ATTTGACTAGTTTTTCTAAGATAAAAAGAATAGCCTTTTAATTACTCACTGGATTATCAT
TTATTCACTCGAAGGGCATTATTCATAGAGTAAAAAATTTCATTATAAATAAATAGTATA
AGAATTTGATTTTTTTAAAAAGGATTTAAAACCATCAAATATATTAATTACTAACTAATT
TATTGTTAAAATTGGTGATTTTGGATCAGCTATTAAAGAAGAGTAAAGAAAGGATAAATA
ATTTTCTATTGAGGGATTCACAAGATGGTATAAGTCTCCAGAGTAGCTTTTTGGATCTAG
GGAGTATAATTACGAAATAGATATTTGGAGTTTTGCATGCATTTATGCTGAAATAATATA
AGGATATCCTTTATTTTCTGGTAAAAAAACTTCTATGTAAATTAATTAATAAATAAAATT
TGAATAATAAAGGTAATAATGAAATAGAATAAATTGCTAAAATATCTGATTTGCTTGGTA
ATCCATGTGAAGAAAATTGGCCTAGTATTGTTAAGATGCCAGATTATGGAAAAATTTTAT
TTAAACAAAAATAAAAAAAAAATTTGAGCACTTTATTTAGTTAAGCTTCTGAAAAAGAAA
TAGAGTTTCTAAATTCAATGTTAAAATATGATAATAGACCTACTGCTGAATAAGTAAATA
GTTTAACATAAATAAAAATTAAATTAATTTTGCTTACATAAATATAGTTATTGCAGAGTG
AATATTTTAAAGATGACTCTGTACCATTAAAATTATAAAACAAAAGTATAATTTTGCCTC
CTAAGCATGAAGATAAGATATATTTTAATTATACTAGCGTGCTAAAAAAATGA