Identifiers and Description

Gene Model Identifier

TTHERM_00286770

Standard Name

CDK4 (Cyclin Dependent Kinase 4)

Aliases

PreTt25907 | 26.m00259 | 3688.m00054

Description

Protein kinase domain containing protein. Sequence similarity to the CDC2 subfamily of the protein kinase CDK family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00286770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09291.19.997093137033517e-262protein kinase domain-containi
ng protein (307 aa)
OxytrichaContig5189.0.g913.0006488705143073e-92Protein kinase domain
SGDYBR160W5.0019535966450705e-92CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
DictyBaseDDB_G02886771.999022616705709e-90cdk5 on chromosome: 5 position
1885785 to 1886770
WormBaseWBGene000004058.997107083354175e-87locus:cdk-1 Cyclin-dependent
kinase 1 status:Confirmed
UniProt:P34556 protein_id:C
AA81590.1
Stentor CoeruleusSteCoe_77832.031092662734811e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000269

Sequences

>TTHERM_00286770(coding)
ATGCTTACTTATTAAAACTTTTAGACTAGATATGTATAGCTAGAAAAATTAGGTGAAGGA
ACTTATGGAGTTGTATTTAAGGCATAAGATATGTAGACATAATAATTAGTAGCTATAAAA
TAGATTAGAATAGACCCTAATGAAGATGAAGGAGTTCCTTCGACTACATTAAGAGAAATA
TCAATTTTGAAGAAGTTAAAACATAAAAATATTGTAAAACTGCTTGATGTTTATGTTTTC
CCTGAAGCTTAAAAAGTATCTTTAGTTTTTGAATATTATCCATAAGATTTAAGAGGCTAC
TTGAAACAGTTGCAACAAAAAAATTAGAAAGAGATCCCTTTAAGCTTCTATTAAAATTAA
TTTAGATAAATAATAGAAGGTGTTGATTATTGTCACTCTTAAGGTATCTTGCATCGTGAT
TTAAAGCCATAAAATATTCTAGTAAGTTCAACTGGAGAAATTAAAATAGCAGATTTTGGA
TTGGCAAGAGCTTTTAACTACCCACTAAAAGAATTAACTAAAGATATAGTCACACTTTGG
TATCGTTCCACAGAACTGTTATTAGGTGAGTCATAATATGATATAGCTATTGATATGTGG
TCAGTTGGATGCATTTTAGCAGAATTTGTTACTTTCAAACCACTCTTCATGGGTGACTCA
TAAATTGATTAACTATTTAAAATATTCTAATTTTCTGGAACACCTAATGGGGTTATTTGG
CCAAATGTTAAGAAGTATATAGATTTTAAGTAGACATTCCCTAAGTTTTTGCCTTCAAAC
ACTTTAAGAATAGATCCAAGATTCAAAGAGTAAATTAGAAATGAAGGAATCGAACTTATA
GAAAGTTTACTTCAAATAGTACCAGAAAAGCGTTTAAATTCAGATGAAGCTCTCAAAGCG
CCTTTCTTCAAGTTAACTTAATGA


>TTHERM_00286770(protein)
MLTYQNFQTRYVQLEKLGEGTYGVVFKAQDMQTQQLVAIKQIRIDPNEDEGVPSTTLREI
SILKKLKHKNIVKLLDVYVFPEAQKVSLVFEYYPQDLRGYLKQLQQKNQKEIPLSFYQNQ
FRQIIEGVDYCHSQGILHRDLKPQNILVSSTGEIKIADFGLARAFNYPLKELTKDIVTLW
YRSTELLLGESQYDIAIDMWSVGCILAEFVTFKPLFMGDSQIDQLFKIFQFSGTPNGVIW
PNVKKYIDFKQTFPKFLPSNTLRIDPRFKEQIRNEGIELIESLLQIVPEKRLNSDEALKA
PFFKLTQ


>TTHERM_00286770(gene)
ATGCTTACTTATTAAAACTTTTAGACTAGATATGTATAGCTAGAAAAATTAGGTGAAGGA
ACTTATGGAGTTGTATTTAAGGCATAAGATATGTAGACATAATAATTAGTAGCTATAAAA
TAGATTAGAATAGACCCTAATGAAGATGAAGGAGTTCCTTCGACTACATTAAGAGAAATA
TCAATTTTGAAGAAGTTAAAACATAAAAATATTGTAAAACTGCTTGATGTTTATGTTTTC
CCTGAAGCTTAAAAAGTATCTTTAGTTTTTGAATATTATCCGTAAAATTAGCTTCATTTT
TTGCAGCAATTTTTTTTATTTAAAATCACATTTTTATATCATATTTAAAAAATAGATAAG
ATTTAAGAGGCTACTTGAAACAGTTGCAACAAAAAAATTAGAAAGAGATCCCTTTAAGCT
TCTATTAAAATTAATTTAGATAAATAATAGAAGGTGTTGATTATTGTCACTCTTAAGGTA
TCTTGCATCGTGATTTAAAGCCATAAAATATTCTAGTAAGTTCAACTGGAGAAATTAAAA
TAGCAGATTTTGGATTGGCAAGAGCTTTTAACTACCCACTAAAAGAATTAACTAAAGATA
TAGTCACACTTTGGTATCGTTCCACAGAACTGTTATTAGGTAAAGTTTGTTTTAAATCTT
TTTCAAGTCAAATAAATATGAAAAATATTAAATACAAAGTCTTAAAAATAGCATATTTGA
TTATTAAAATAAAATTAAATGAATGTTCTCATAACAAAATAATTATGAAATAGGTGAGTC
ATAATATGATATAGCTATTGATATGTGGTCAGTTGGATGCATTTTAGCAGAATTTGTTAC
TTTCAAACCACTCTTCATGGGTGACTCATAAATTGATTAACTATTTAAAATATTCTAATT
TTCTGGAACACCTAATGGGGTTATTTGGCCAAATGTTAAGAAGTATATAGATTTTAAGTA
GACATTCCCTAAGTTTTTGCCTTCAAACACTTTAAGAATAGATCCAAGATTCAAAGAGTA
AATTAGAAATGAAGGAATCGAACTTATAGAAAGTTTACTTCAAATAGTACCAGAAAAGCG
TTTAAATTCAGATGAAGCTCTCAAAGCGCCTTTCTTCAAGTTAACTTAATGA