Identifiers and Description

Gene Model Identifier

TTHERM_00011670

Standard Name

CDK3 (Cyclin-Dependent Kinase 3)

Aliases

PreTt11773 | 1.m00821

Description

Protein kinase domain containing protein; sequence similarity to the CRK7 subfamily of the protein kinase CDK family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF02701 ) Dof domain, zinc finger
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00011670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02777.19.997093137033517e-262protein kinase domain-containi
ng protein (666 aa)
OxytrichaContig17113.0.g224.9995060293141384e-98Protein kinase domain
DictyBaseDDB_G02737217.001141985045207e-89cdk9-2 on chromosome: 2 positi
on 3321422 to 3323747
WormBaseWBGene000071359.998074580622396e-81locus:cdk-12 status:Partiall
y_confirmed UniProt:C8JQR0
protein_id:CBB15981.1
SGDYKL139W8.997587713565275e-70CTK1 Catalytic (alpha) subunit
of C-terminal domain kinase I
(CTDK-I); phosphorylates both
RNA pol II subunit Rpo21p to
affect transcription and pre-m
RNA 3 end processing, and ribo
somal protein Rps2p to increas
e translational fidelity; simi
lar to the Drosophila dCDK12 a
nd human CDK12 and probably CD
K13
Stentor CoeruleusSteCoe_181971.0112214926104486e-43

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000255

Sequences

>TTHERM_00011670(coding)
ATGGAAAAGAATAGCAATAGCCAGCAAAGTGGCTCTTAAACCGTTCCAATAAGAACTAGA
AATATAAGAAAGTATTATAGATTGATAGCAGAAGTTGGGTCAGGAACCTATGGTAGAGTT
TATAAGGCAGAATGTCTGCGAACTAAATAGTATGTTGCTCTCAAAAAATTCGAAAGCAAA
GATGATAAAATTAAAGAAGACGGATTTCCAATTACAGCAGTGCGTGAAATTCTTTTGCTA
AAATAATTAGACCATGTCAATATTATCAAATTAAGGGAAATTATTTTGTCAAAGCCTTCT
GAAAAAAACGACTACCGTGGTTCCACATTTTTAGTTTTTGATTACATGGATCACGATTTT
GCTGGATTGCATAGAAATAAACATGAATTTTCTCTTTAGGAGCTCAAATGCATCATGAAA
TAAATTCTATTAGGCGTACAATATCTTCACTATAAGAAAGTCATTCACAGAGACTTGAAA
ATAGCAAACATATTATATAACAATTAAGGAGAGGTTAAAATAGCTGATTTCGGTTTAGCA
AGATTGCTTAATCCAAACAATCCAAAGTATACAAATAAAGTAGTAACTCTCTGGTACAGA
GCTCCTGAGCTGCTTCTAGGAGCAAAGGAATATACAGAGCAAATTGACATGTGGAGTGTT
GGATGTATTTTCATTGAACTTGCAGTTGGTGAAAATTTACTTAGAGGTGAGAATGAGCCA
AGATAACTAGATAAAATCTATGAATTATGTGGCAGCCCCAACACCTAAAATTGGCCTGAA
GTCGACAAACTTCAGCTTTGGAAGGACATGAAACCCAAAAGAAATTTTGAAAGAAAACTT
AGAGAATAGGTGATTGAAAGAAAAAAAAATATTGATCCTTAGTTTTTAAATTTATTAGAT
GGGATTATGGTCTTGAATCCTAAGAAAAGATTTACTGTTCAATAATGTCTTGACCATGAA
TTCTTTAAAGTAGAACCTCTGCCTTTTGAAATTAGTGAAATGCCAAAAATAAAAGAAGAG
TGTCATGAAGCTCTTCTAAAAAATGTAAAAAATAGAAACCAAGTCATATAATCTCATAAA
AATAATTTCATGTAAAGAGCAAATATGTCTCCTTCTAGAATCCCTCCAATGAGCACCTAA
AATTAATAGGGATAAAAGTCATATTCCAGCTCTTAAAATTAATTGTCGTCAAATAAGTAA
AGCACAAGCAGTATATAAAATGCATCATCTTCATAATAAGGAAATTAGATAGTTGGATAG
TCTCACTTTGACTCCAGAAACAGTGGGAAAAGCCACTTTTAGTAAAAATAATAAAGTAGC
AGCAGCAATAGCAGCTAGTAATACTCAAGAGAACACATCAGCAATAGTAAGGGAGGCTAT
TATGGAAACTCAAATAATTCGAGTTCTATGAAATACACTAGCGGGGGTGCTTAGTAGAAT
ATTCCGTTAGACAGCGGGCCGAATCTTAAAAAGTAAGGCAGTTCTACAGTAGGATAAAAC
CAATAACAGTAATACCTAAACCCACCATATAAAAAGAAAACCAGCATTCAGCTTAGTGGG
GATAATAATAACGATTATCCATCAATTGAGCATCATTTGGATAACAGCAATAAAAGCGTC
ACTAACGAATCTCAAGTGGCTTAACCCAATTAAAGTTCTAAATTTAATTCATTTTCAGGG
CTTGCATCTCTTGTCTAAAAGTAAGGATCTGTTGATAGACAAGTGCATATCCCTCTGGAA
AACAGTGGTCACAAGAAGCAAGTAGAAGATGAAGATGATGACTATGAAAATTAATCAACA
GCTTAAGTCCATAAAAAATAAAGCAATCTCTCTATGCTCACAAGTAATGCATCTACCTTT
ATGTATAACAGCATCAATAATAATAACGATGATCCTATCATCAACCATCTTTCTAAAATT
AATCAAAAAAGATCACCTCCCTCAGAAATATACGATATAAATATTAAGAAAAAAATCAAA
GAAGACTGA


>TTHERM_00011670(protein)
MEKNSNSQQSGSQTVPIRTRNIRKYYRLIAEVGSGTYGRVYKAECLRTKQYVALKKFESK
DDKIKEDGFPITAVREILLLKQLDHVNIIKLREIILSKPSEKNDYRGSTFLVFDYMDHDF
AGLHRNKHEFSLQELKCIMKQILLGVQYLHYKKVIHRDLKIANILYNNQGEVKIADFGLA
RLLNPNNPKYTNKVVTLWYRAPELLLGAKEYTEQIDMWSVGCIFIELAVGENLLRGENEP
RQLDKIYELCGSPNTQNWPEVDKLQLWKDMKPKRNFERKLREQVIERKKNIDPQFLNLLD
GIMVLNPKKRFTVQQCLDHEFFKVEPLPFEISEMPKIKEECHEALLKNVKNRNQVIQSHK
NNFMQRANMSPSRIPPMSTQNQQGQKSYSSSQNQLSSNKQSTSSIQNASSSQQGNQIVGQ
SHFDSRNSGKSHFQQKQQSSSSNSSQQYSREHISNSKGGYYGNSNNSSSMKYTSGGAQQN
IPLDSGPNLKKQGSSTVGQNQQQQYLNPPYKKKTSIQLSGDNNNDYPSIEHHLDNSNKSV
TNESQVAQPNQSSKFNSFSGLASLVQKQGSVDRQVHIPLENSGHKKQVEDEDDDYENQST
AQVHKKQSNLSMLTSNASTFMYNSINNNNDDPIINHLSKINQKRSPPSEIYDINIKKKIK
ED


>TTHERM_00011670(gene)
ATGGAAAAGAATAGCAATAGCCAGCAAAGTGGCTCTTAAACCGTTCCAATAAGAACTAGA
AATATAAGAAAGTATTATAGATTGATAGCAGAAGTTGGGTCAGGAACCTATGGTAGAGTT
TATAAGGCAGAATGTCTGCGAACTAAATAGTATGTTGCTCTCAAAAAATTCGAAAGCAAA
GATGATAAAATTAAAGAAGACGGATTTCCAATTACAGCAGTGCGTGAAATTCTTTTGCTA
AAATAATTAGACCATGTCAATATTATCAAATTAAGGGAAATTATTTTGTCAAAGCCTTCT
GAAAAAAACGACTACCGTGGTTCCACATTTTTAGTTTTTGATTACATGGATCACGATTTT
GCTGGATTGCATAGAAATAAACATGAATTTTCTCTTTAGGAGCTCAAATGCATCATGAAA
TAAATTCTATTAGGCGTACAATATCTTCACTATAAGAAAGTCATTCACAGAGACTTGAAA
ATAGCAAACATATTATATAACAATTAAGGAGAGGTTAAAATAGCTGATTTCGGTTTAGCA
AGATTGCTTAATCCAAACAATCCAAAGTATACAAATAAAGTAGTAACTCTCTGGTACAGA
GCTCCTGAGCTGCTTCTAGGAGCAAAGGAATATACAGAGCAAGTAATATCAAAATAATTT
AAAACTAAATACACTACAAAATAATTTGGCTTATTTATTTACAGTGCAGCATATATTGAA
AGAATTAATAAGAAACATTAAAAGCATCTAACTTAGCCTTCTTATTAGCATATATTTAAA
GCTAACAGTCTAAAGTAGTATTTTCAAAAAATCAAACAAGCAAGTAAACAAACAAACAAA
GTTCCTGGCTAAAATAAAAAATATAATTTAGTTTTCCATTAAAAGTATTTTTCATACAAT
TTCAAAAGAAAAAAATTAGAAAAATGAAAATATTAAAAAAAAGTTAGCTATTTTTATAAA
AAATTCATTAAGATGAGCTTAAAAAAAATTATTACTATAAAGATTTCACTGTAATTTCAA
GCACAAAAAATAGAAAATAGCTTCAGAAAAAATAACTTTGTTTCTTAATTGATTTTAATT
GATAAATAGAAAAATAAATAACCTAAATATATATTAATTAATTAATTTATAATTATATTA
ATAAAAGATTGACATGTGGAGTGTTGGATGTATTTTCATTGAACTTGCAGTTGGTGAAAA
TTTACTTAGAGGTGAGAATGAGCCAAGATAACTAGATAAAATCTATGAATTATGTGGCAG
CCCCAACACCTAAAATTGGCCTGAAGTCGACAAACTTCAGCTTTGGAAGGACATGAAACC
CAAAAGAAATTTTGAAAGAAAACTTAGAGAATAGGTGATTGAAAGAAAAAAAAATATTGA
TCCTTAGTTTTTAAATTTATTAGATGGGATTATGGTCTTGAATCCTAAGAAAAGATTTAC
TGTTCAATAATGTCTTGACCATGAATTCTTTAAAGTAGAACCTCTGCCTTTTGAAATTAG
TGAAATGCCAAAAATAAAAGAAGAGTGTCATGAAGCTCTTCTAAAAAATGTAAAAAATAG
AAACCAAGTCATATAATCTCATAAAAATAATTTCATGTAAAGAGCAAATATGTCTCCTTC
TAGAATCCCTCCAATGAGCACCTAAAATTAATAGGGATAAAAGTCATATTCCAGCTCTTA
AAATTAATTGTCGTCAAATAAGTAAAGCACAAGCAGTATATAAAATGCATCATCTTCATA
ATAAGGAAATTAGATAGTTGGATAGTCTCACTTTGACTCCAGAAACAGTGGGAAAAGCCA
CTTTTAGTAAAAATAATAAAGTAGCAGCAGCAATAGCAGCTAGTAATACTCAAGAGAACA
CATCAGCAATAGTAAGGGAGGCTATTATGGAAACTCAAATAATTCGAGTTCTATGAAATA
CACTAGCGGGGGTGCTTAGTAGAATATTCCGTTAGACAGCGGGCCGAATCTTAAAAAGTA
AGGCAGTTCTACAGTAGGATAAAACCAATAACAGTAATACCTAAACCCACCATATAAAAA
GAAAACCAGCATTCAGCTTAGTGGGGATAATAATAACGATTATCCATCAATTGAGCATCA
TTTGGATAACAGCAATAAAAGCGTCACTAACGAATCTCAAGTGGCTTAACCCAATTAAAG
TTCTAAATTTAATTCATTTTCAGGGCTTGCATCTCTTGTCTAAAAGTAAGGATCTGTTGA
TAGACAAGTGCATATCCCTCTGGAAAACAGTGGTCACAAGAAGCAAGTAGAAGATGAAGA
TGATGACTATGAAAATTAATCAACAGCTTAAGTCCATAAAAAATAAAGCAATCTCTCTAT
GCTCACAAGTAATGCATCTACCTTTATGTATAACAGCATCAATAATAATAACGATGATCC
TATCATCAACCATCTTTCTAAAATTAATCAAAAAAGATCACCTCCCTCAGAAATATACGA
TATAAATATTAAGAAAAAAATCAAAGAAGACTGA