Identifiers and Description

Gene Model Identifier

TTHERM_000937671

Standard Name

CDK22 (Cyclin-Dependent Kinase 22)

Aliases

None

Description

kinase domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_000937671

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40732.11.9999590304423412e-72hypothetical protein (643 aa)
OxytrichaContig79.1.g511.9999391735788327e-19Protein kinase domain
WormBaseWBGene000004079.99946582325553e-18locus:cdk-5 status:Confirmed
UniProt:G5ECH7 protein_id
:CAB04875.1
DictyBaseDDB_G02923900.000000000000004001928599951003atg1 on chromosome: 6 position
1694801 to 1697129
SGDYBR160W0.000000000000004001928599951003CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000937671(coding)
ATGAATATGTAACAAAGAATCAAGGAAATAGCAAAAAAAACCTAGGGCTGCAGCATCGAT
AATCAAAGAATCTTTATGTTCTTCTAACAGCTTAGAAAATAGCAGAAACATTACAATGAT
TTTGAATATTTGGGAAATGGATCATTCGCTTTAGTAATTAAAGCTATTAACAAGAATTCT
CAAAAATAAGTTGCACTAAAAATTGTACTATGCAACTAAAATGAATCTAACGAGGAAGAG
TCTGCTTTGAAAGAGTACGATTTACTTAAGAAGATTAAGCATTGTCCATATCTTGTTGAT
GTTTACAATCAATTCTATGTCTATGAAGAAGAAATCATTATTTAAGATTCAGATGATGAA
GAGTAAATAGCTGAAAAACCTAAAAATCAAAATGAAAAATTGAAGTCCTTCTTAGTCTTA
GAACTCGAATTTTGCAAGACAAATTTAGCAGACTACTTTAGATATTGTAGAGAAAAGAAT
CAATATCCTGATAAGAAAATGAAAGAAATCCTAACTATCCAAATTCTTGATGGAATATCC
TTCCTCCATTAGAAATCGTTCCTACATCGAGATATCAAACCAAACAACATCCTTCTTTAG
TTTGATAACTAAAACAATCCGATTATCAAGATTTGTGATTTAGGTTTTGCATCTTTCATA
TCTCCAAGCCAATCAAAGATCCACACTAAATAGAAAGGAACTAGGGAATATATGCCTCCA
GAATCATAGTTAGACATTTGGAGAAGAGAAAGTGACCTATTCTAAGTTGGGATAGTTCTA
TTAGAACTAGATAACATTCAAAAGTTTGACTTCTTGAAGACTACAGATGATGAAAGGTAC
GTTCTAAGAAACGGTTAAATATTCCCAAATTAATCACTTGACAGAAAATCTAACATTTTC
TAAATTGCTTAAACTTTCTTGAATCCTAACATTAAAGAACGTTAATCTGCATAAATGTTT
CTTGAATGGCTTATATGGAAAGATCCGTAATATCAAAGTATTGAATTGAGTTCTATCATC
ATAATGCCATAATTAGGGAAGAAAGTACATGAAATACTAAACAGTAATCCTCAGTAGGAA
TAAGGTCTTAATGTAAGTTAAAAAATTTAAGAATCTATGTGGAAATCCTAAATCATGCAC
AAGGTAAGCTAGATCAATTAAAGCTAAAATTCTATTTAAGCCATGTCATAATCTTAGATT
TATAAGGTTTAAATTTAGAGCTTGCTAAATGACTACTAAAGCATGATAAAATATAGAATT
TTTACAGAAGATGAATTGAAAAAAGCAATGCTATTACTATTTAACAATACAAACTATAGT
AAGAGCTTTAATCTGATCAACCAAGGAGGGAAAGGAGTTATTATAGGTGCATATAATTTG
AAAGATAAAAGAGATTGTGTACTGAAAATATAAAAGGTTCAATCAAAATCTCGTATAATA
AAAGAAATTAGCATTCTTAAATGCTGTCAAATGCCTTTAATTGTAAAATTATACAATTCA
TTTTATCTTGATGTTGCTAAAAAGGAGGATTTCGTAGTCTATGAGTTAGAAAAGTGTGAT
TGTGACCTTAAAGCTTACTTAGAAAAAAAGTAAAATGGTTAGCAATTATCTTAAGAAGTT
AAAGAAGAAATTGCTATTTAAATGATGGATTCTGTTAATTACATGCATAAACATAATATC
ATCCACAGAGATATTAAGCCTTAAAATTTTTTAGTTTAAGAAAGCAATAGCTCTATCCCA
GCAATCAAATTAAGTGACTTTGATGAAGCTGATTATTTAAGATTAGATTAAGATTTAGAT
TACGATCATTTCTTTAATACAGGAGATTGGACTGTAAAAGAATATTTTGCACCTAATTGT
GATGGGTGTGGAACATTTGGTTATTGGGCACCTGAGTAAATATACTAAAAGTAATCAACA
ATTGAAAGTGATGTATTTAGTCTAGGAATATCTTTATCTTTGTTAGATAACTTTTAAAAA
TTATAACCTTTATATCATTTTGAAAGTTTAAAAATTGGAAAATATTTTGCGGAAGCTTTT
GAACCTTATAATGGCTAATTAGATTTAATTAATAGAAAAACTAAAATTTATTAGAAAGCA
ATTATGTACTCATTAGTTTATGATAAATACAAAAGAAAAGATTTATCATAAATTTTAGAT
GATTTCAAATAAAATTATTTTTCTAAAGAGATAAAATAAATTTCTTTAATAAATGATCAT
GAAATTGCTTAAATTAGTATAAAGGATAACAACATTGGTGCAGAAGGAGCAAAACATATT
GCAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTTGAGGGAAAT
GAAATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCAAAATATC
ACTTCTTTGAATCTCAATCTTGAGGATAACAACATTGGTGCAGAAGGAGCAAAACATATT
GCAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGTAATTT
TTTGAAGTTGTAAAATATGAAAGGAAGAAAAATCAAATTGGTGCAGAAGGAGCAAAACAT
ATTGCAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGGAT
AATAAGATTGGTGCAGAAGGAGCAAAACATATTGGAATGAGCTTAGAAAAGTGTCAAAAT
ATCACTTCTTTGAATCTCAATCTTGTGGGAAATGAAATTGGTGCATGGAAATGGAAATGG
AAATACTCGCACATATAATTTTTTGAAATTGGTGCAGAAGGAGCAAAACATATTGGAATG
AGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGTACAACAACATT
GGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCAAAATATCACTTTT
TTCAATTTATATGTGAGAAAGGGAAACAATTTGAATGAAAAAGCATTTTTAGATTTAAAC
TAAATTTCTAATAAGCTTTATTAATTATAAAAACTATAGATTTAATGA


>TTHERM_000937671(protein)
MNMQQRIKEIAKKTQGCSIDNQRIFMFFQQLRKQQKHYNDFEYLGNGSFALVIKAINKNS
QKQVALKIVLCNQNESNEEESALKEYDLLKKIKHCPYLVDVYNQFYVYEEEIIIQDSDDE
EQIAEKPKNQNEKLKSFLVLELEFCKTNLADYFRYCREKNQYPDKKMKEILTIQILDGIS
FLHQKSFLHRDIKPNNILLQFDNQNNPIIKICDLGFASFISPSQSKIHTKQKGTREYMPP
ESQLDIWRRESDLFQVGIVLLELDNIQKFDFLKTTDDERYVLRNGQIFPNQSLDRKSNIF
QIAQTFLNPNIKERQSAQMFLEWLIWKDPQYQSIELSSIIIMPQLGKKVHEILNSNPQQE
QGLNVSQKIQESMWKSQIMHKVSQINQSQNSIQAMSQSQIYKVQIQSLLNDYQSMIKYRI
FTEDELKKAMLLLFNNTNYSKSFNLINQGGKGVIIGAYNLKDKRDCVLKIQKVQSKSRII
KEISILKCCQMPLIVKLYNSFYLDVAKKEDFVVYELEKCDCDLKAYLEKKQNGQQLSQEV
KEEIAIQMMDSVNYMHKHNIIHRDIKPQNFLVQESNSSIPAIKLSDFDEADYLRLDQDLD
YDHFFNTGDWTVKEYFAPNCDGCGTFGYWAPEQIYQKQSTIESDVFSLGISLSLLDNFQK
LQPLYHFESLKIGKYFAEAFEPYNGQLDLINRKTKIYQKAIMYSLVYDKYKRKDLSQILD
DFKQNYFSKEIKQISLINDHEIAQISIKDNNIGAEGAKHIAMSLEKCQNITSLNLNLEGN
EIGAEGAKHIAMSLEKCQNITSLNLNLEDNNIGAEGAKHIAMSLEKCQNITSLNLNLWQF
FEVVKYERKKNQIGAEGAKHIAMSLEKCQNITSLNLNLWDNKIGAEGAKHIGMSLEKCQN
ITSLNLNLVGNEIGAWKWKWKYSHIQFFEIGAEGAKHIGMSLEKCQNITSLNLNLWYNNI
GAEGAKHIAMSLEKCQNITFFNLYVRKGNNLNEKAFLDLNQISNKLYQLQKLQIQ


>TTHERM_000937671(gene)
ATGAATATGTAACAAAGAATCAAGGAAATAGCAAAAAAAACCTAGGGCTGCAGCATCGAT
AATCAAAGAATCTTTATGTTCTTCTAACAGCTTAGAAAATAGCAGAAACATTACAATGAT
TTTGAATATTTGGGAAATGGATCATTCGCTTTAGTAATTAAAGCTATTAACAAGAATTCT
CAAAAATAAGTTGCACTAAAAATTGTACTATGCAACTAAAATGAATCTAACGAGGAAGAG
TCTGCTTTGAAAGAGTACGATTTACTTAAGAAGATTAAGCATTGTCCATATCTTGTTGAT
GTTTACAATCAATTCTATGTCTATGAAGAAGAAATCATTATTTAAGATTCAGATGATGAA
GAGTAAATAGCTGAAAAACCTAAAAATCAAAATGAAAAATTGAAGTCCTTCTTAGTCTTA
GAACTCGAATTTTGCAAGAGTAAAGATTATTAAACCATTTTATATTTAAATTTTAACAAA
AAAGTAGATCAAAAAACAGATTACTATGAATAATATCAATCAGTTTAAACGTATGATTAA
ATTTCAACTTTTTGATAATAAACGCCATTTTAAGCTTGTCAATTTAAAGGGTTTAGAGTG
TTTAGCTTAGTTTTAATGCCCACACTCAAATATTTGGAAGTTAAATGAAGACATTATTGA
TAATTTTGATTATTGAGCATTAAGATAAAATCATAATAATAATCAAATTAATGAACAATG
AATGAAAATAGATAGGAAAGATGTTTTACTTTTTCTTGTTTTTCAAGTCAACTAATTAAT
ATATTGAATGACTTTGATAATTAAAGATATTTTTATTAAATCAATTGATTAATAAAATAA
ATGAATATCCCAAACTCATTTATTTATTTCATCTCTTTAGTTATCATATAGCATGAATGA
ATTTCATTCAAATATAAGAAGAAAATTTAATATGGTGATTCATTCATTTTTACATAAAAT
TTGCATCCTTCATTGCTTTTAACATATATTTTATTTACTTCCTTAAATTTCATTAATTTT
ACAAAAATTGTATTATGGATCATTCATTATTTCATTCATTTTGATGAATTTTTTCTTACT
AATTTTTGTGATGAAAATCTTCATTGATTTTTTATGAATTAATTTACTAACTATTTTTAG
ATTTCATATCTTTTTCTTATCAAACAAAACTATTAATATTGTCATCATACATCTGAATAC
AAGAGATATTTCTTAATACTATATTGATTTACATTTTTTATTACCCCTTTATATTTTATT
AATATTGATAAGCGCAATTATTAACAATAAATAAATTTATGGCAAATATAATCTTTATTC
ATTATTAATCATATTATACAAAACAAATTGAATATTAAACTAAAAAATTATTAATTTTAT
AATAAATTATTGAATAATTAAATTAATTTCAAATAAATTAATGAATCCAAAATATTATTA
AATTAAAAATATAGATTATACAATTATAAATTAACAAAATGAAAAATAAATAAATAATAA
ACATAACCAATAAACAAAAGAAATATAACCATTTAATAAAGTAGATATCTTTACATGTTT
TTATTTAACAAGAAAAAGATAAAAATAAGAAAACTTTTTATAAAAATGGCAATTTCCAAA
TAAAAATACAAAAAGTATTAAAATAGGCATTAATTTTTTGTTAAATATTTATAAAAAGGA
GCAAAATTTATGATTTTTTCTAAAATATTCCTATTTTAAAAATATAAATATTTATAAATG
ATCATATTTTTTACATTTATTTTAAATTTAAATAGCAAATTTAGCAGACTACTTTAGATA
TTGTAGAGAAAAGAATCAATATCCTGATAAGAAAATGAAAGAAATCCTAACTATCCAAAT
TCTTGATGGAATATCCTTCCTCCATTAGAAATCGTTCCTACATCGAGATATCAAACCAAA
CAACATCCTTCTTTAGTTTGATAACTAAAACAATCCGATTATCAAGATTTGTAAATATTT
TTATTTAAATTTACATATTTCTAAATAAAATAGAAATACTCTACTCTCAAGACAAAATTT
CAAAATAAATCTTAGAAATTTTGAATAATTTTAGATTTTTTTGATTTTAATTAAAAATTA
AATAAGGTTAATAACTTTAAATTAATATTTTCATTTTTGATTAAAATTTAAAAATAAACT
TTATCAATAACTTTTTAAAGAAAAAAATAATAACAATTTAGAAATTTTATTAAAAAATAA
TATTTTTTCTTAATTTTAGATGTAGTATAAGCAAATCAATAATTTTATGTCTTAAAATTT
TATGATTATATTTGTTAAGATAACAAATATTAGTTTTAAATTTCATTAAAATATATTTTA
AAATGAAAGCTTGATTATTATAATCTCTACACATACAAATAACTTTTAATTTTAAGAAAT
CAATAATAAATCTATAAAAAAAAATAATATTTTTTAGGTGATTTAGGTTTTGCATCTTTC
ATATCTCCAAGCCAATCAAAGATCCACACTAAATAGGTAAATTAATTCTTTTAGTTTTTT
TATAACCTAAAAGAATTATATAAAAATTAGAAAGGAACTAGGGAATATATGCCTCCAGAA
TCATAGTTAGACATTTGGAGAAGAGAAGTAAACTTTTTGTTATTTTAATAAACATTAAAT
AAATCATTTTAAAGAGTGACCTATTCTAAGTTGGGATAGTTCTATTAGAACTAGATAACA
TTCAAAAGTTTGACTTCTTGAAGACTACAGATGATGAAAGGTACGTTCTAAGAAACGGTT
AAATATTCCCAAATTAATCACTTGACAGAAAATCTAACATTTTCTAAATTGCTTAAACTT
TCTTGAATCCTAACATTAAAGAACGTTAATCTGCATAAATGTTTCTTGAATGGCTTATAT
GGAAAGATCCGTAATATCAAAGTATTGAATTGAGTTCTATCATCATAATGGTAATAATTA
ATATTGTCTGACCACTTATAAATTAAAAAAAGATATGTTTTAAGATTTGAGACATTTTAA
ACTTTGTTGATAAATAACTCATTTAAATTAATCTTCTAATTAAAAGTTTTAAAACAGTTT
TATTAACTTTTAATTTAACTTCTTTTAACTTTGAAATGTGCTATATATATCATTTTATAG
CTTAAAAAACAATAAAATAAATATTTAATTAAAATTTATATTTTTCTTTTTCATTTAAAT
AAATTTTGATTGTAGTTTAAAAAAATATTGAAAATAATTTAAAAATTAATTTTAATTTAT
CAGCCATAATTAGGGAAGAAAGTACATGAAATACTAAACAGTAATCCTCAGTAGGAATAA
GGTCTTAATGTAAGTTAAAAAATTTAAGAATCTATGTGGAAAGTAATTAATTTATTTCTC
AAAAAATATTTGGTTCAAAATTTAATTGCAGAATTTTTTTAAAATCTAATTAAAATCCTT
AAATAAAATAGATTTATCATTTTTAAAAGGTATTAATTAAAATATAATAGAATATATTTA
TTTATTTATCAATCGGCTTTAAAAAATTATTTTAATACTAAAATAAATTATTATTTGTTA
AGAATATAAAATTTCAACAAATTATTAATCAGTTATTAAGTTATCTAAGATTTAAATTTT
ATTTTTAATAAAAGTCCTAAATCATGCACAAGGTAAGCTAGATCAATTAAAGCTAAAATT
CTATTTAAGCCATGTCATAATCTTAGATTTATAAGGTAAAAAGCATTTTATAAATTTATG
GATTATATTTTTAATTGTTTTTTAAAAATTAGGTTTAAATTTAGAGCTTGCTAAATGACT
ACTAAAGCATGATAAAATATAGAATTTTTACAGAAGATGAATTGAAAAAAGCAATGCTAT
TACTATTTAACAATACAAACTATAGTAAGAGCTTTAATCTGATCAACCAAGGAGGGAAAG
GAGTTATTATAGGTGCATATAATTTGAAAGATAAAAGAGATTGTGTACTGAAAATATAAA
AGGTTCAATCAAAATCTCGTATAATAAAAGAAATTAGCATTCTTAAATGCTGTCAAATGC
CTTTAATTGTAAAATTATACAATTCATTTTATCTTGATGTTGCTAAAAAGGAGGATTTCG
TAGTCTATGAGTTAGAAAAGTGTGATTGTAAACCATTACTTTTTATTTTAATATAATAGG
AAAAGTGTAGTTTAGACAGATTTTTTAAGTACAAATTTTTATAAATTTTTTTTAATCAAG
TTGATAAAAAATTTATAAAAATTGGTTCTTAAAAAATCTGTCAAGACTACACTTTTCCTA
TTATATATTTTATTCTTAATTTTTGTTAAATTAGAATATATTTATTATTTATTTATTGAA
TAGGTGACCTTAAAGCTTACTTAGAAAAAAAGTAAAATGGTTAGCAATTATCTTAAGAAG
TTAAAGAAGAAATTGCTATTTAAATGATGGATTCTGTTAATTACATGCATAAACATAATA
TCATCCACAGAGATATTAAGCCTTAAAATTTTTTAGTTTAAGAAAGCAATAGCTCTATCC
CAGCAATCAAATTAAGTAATTATTCTCTTCATGTTGTTAATTTCTCAATATTTTATTCTA
ATCACATTAAATTAATTTAATGTTATTTAAACATTTTTTGACTAAATTTTATTTTTATAC
ATTTTAATTAGATTTTATCAATAATAAAAATAATTTTATTATTATATTTGAGTTTTATTT
TTCTTTTATTTTTATTCTTAGGTGACTTTGATGAAGCTGATTATTTAAGATTAGATTAAG
ATTTAGATTACGATCATTTCTTTAATACAGGAGATTGGACTGTAAAAGAATATTTTGCAC
CTAATTGTGATGGGGTAAAAAATAAAATAAATTTTAAGTAAATATTTATTATTTTGTTAT
AAGTGTGGAACATTTGGTTATTGGGCACCTGAGTAAATATACTAAAAGTAATCAACAATT
GAAGTAAATAAATTAGATTAAAATTTGATTAGATTTGAATGAAATTTAATTTAAATTACT
TTAGAGTGATGTATTTAGTCTAGGAATATCTTTATCTTTGTTAGATAACTTTTAAAAATT
ATAACCTTTATATCATTTTGAAAGTTTAAAAATTGGAAAATATTTTGCGGAAGCTTTTGA
ACCTTATAATGGCTAATTAGATTTAATTAATAGAAAAACTAAAATTTATTAGAAAGCAAT
TATGTACTCATTAGTTTATGATAAATACAAAAGAAAAGATTTATCATAAATTTTAGATGA
TTTCAAATAAAATTATTTTTCTAAAGAGATAAAATAAGTAAAATAATAATCATTTTATGT
TTTTCAAATTATTTTAGAATTTTTATTTTTCAATATTTCTAATTTAGTGCTATTATTTAA
CAAAAATAAGTTTATTTATTTATTTTTATTAAATAATTCGATTAGATTTCTTTAATAAAT
GATCATGAAATTGCTTAAATTAGTATAAAGTAATTTTTATAACTTTGTATTATTTATTTA
ATTTTTTAAATTAATATATTTATGAAAGTTGATTATACTTGCCTTAAAATTAGTGTACGA
CTTATTTTTAAGCATTTTGTATTATATAAATTATAATTAAATTAAAAAAAAACTTTAAAA
TTGTTTTTTAACTATTTATATTGTAATTTAGTTATAATTGCTATTAATTTTTGATAATTT
GATAAAAATTTCTAATCAAATTCAAACAAACAAAAAAACATATTTTAATAATATTTTTGA
AGGGATAACAACATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGT
CAAAATATCACTTCTTTGAATCTCAATCTTGAGTAATTTTGTTAAATATTTATTTGATTA
AGTTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGTAAATAAGTGGTTAAT
TTGTTAAGCAAAAGATGCTTTTGATTATGAATGAATCAATTCATTCAATCACTCATTTCT
TCATTCAAATATCTTCTTTTTTTTTTTAATTATTTAATTAATTAATTACTTACATACATA
CTCATCCAGCTACTTATTTATTTTAATTTTCAATTTATTTTATTATGATTTTCAAAACAA
ATTCAAACAAACAAAAAAACATATTTTAATAATATTTTTGAAGGGGAAATGAAATTGGTG
CAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGA
ATCTCAATGTTAGGTAATTTTGTTAAATATTTATTTGATTAAGTTTGTTAGTTGAAGTTG
TAAAATATGAAAGGAAGTAAAGAAGTAAATAAGTGGTTAATTTGTTAAGCAAAAGATGCT
TTTGATTATGAATGAATCAATTCATTCAATCACTCATTTCTTCATTCAAATATCTTCTTT
TTTTTTATTTAATTATTTAATTAATTAATTACTTACATACATACTCATCCAGCTACTTAC
TTATTTTAATTTTCAATTTATTTTATTATGATTTTCAAAACAAATTAAAACAAACAAAAA
AACATATTTTAATAATATTTTTGAAGGGGAAATGAAATTGGTGCAGAAGGAGCAAAACAT
ATTGCAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTTGAGTAA
TTTTGTTAAATATTTATTTGATTAAGTTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAG
TAAAGAAGTAAATAAGTGGTTAATTTGTTAAGCAAAAGATGCTTTTGATTATGAATGAAT
CAATTCATTCAATCACTCATTTCTTCATTCAAATATCTTCTTTTTTTTTATTTAATTATT
TAATTAATTAATTACTTACATACATACTCATCCAGCTACTTATTTATTTTAATTTTCAAT
TTATTTTATTATGATTTTCAAAACAAATTCAAACAAACAAAAAAACATATTTTAATAATA
TTTTTGAAGGGATAACAACATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGA
AAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGTAATTTTGTTAAATATTTAT
TTGATTAAGTTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGTAAATAAGT
GGTTAATTTGTTAAGCAAAAGATGCTTTTGATTATGAATGAATCAATTCATTCAATCACT
CATTTCTTCATTCAAATATCTTCTTTTTTTTTATTTAATTATTTAATTAATTAATTACTT
ACATACATACTCATCCAGCTACTTATTTATTTTAATTTTCAATTTATTTTATTATGATTT
TCAAAACAAATTCAAACAAACAAAAAAACATATTTTAATAATATTTTTGAAGGGATAACA
ACATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCAAAATATCA
CTTCTTTGAATCTCAATCTATGGTAATTTTGTTAAATATTTATTTGATTAAGTTTGTTAG
TTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGTAAATAAGTGGTTAATTTGTTAAGCA
AAAGATGCTTTTGATTATGAATGAATCAATTCATTCAATCACTCATTTCTTCATTCAAAT
ATCTTCTTTTTTTTTATTTAATTATTTAATTAATTAATTACTTACATACATACTCATCCA
GCTACTTACTTATTTTAATTTTCAATTTATTTTATTATGATTTTCAAAACAAATTCAAAC
AAACAAAAAAACATATTTTAATAATATTTTTGAAGGGATAATAAGATTGGTGCAGAAGGA
GCAAAACATATTGGAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAAT
CTTGTGTAATTTTGTTAAATATTTATTTGATTAAGTTTGTTAGTTGAAGTTGTAAAATAT
GAAAGGAAGTAAAGAAGTAAATAAGTGGTTAATTTGTTAAGCAAAAGATGCTTTTGATTA
TGAATGAGTCAATTCATTCAATCACTCATTTCTTCATTCAAATATCTTCTTTTTTTTATT
TAATTATTTAATTAATTAATTACTTACATACATACTCATCCAGCTACTTATTTATTTTAA
TTTTCAATTTATTTTATTATGATTTTCAAAACAAATTCAAACAAACAAAAAAACATATTT
TAATAATATTTTTGAAGGAAAAATCAAATTGGTGCAGAAGGAGCAAAACATATTGCAATG
AGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGTAATTTTGTTAA
ATATTTATTTGATTAAGTTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGT
AAATAAGTGGTTAATTTGTTAAGCAAAAGATGCTTTTGATTATGAATGAATCAATTCATT
CAATCACTCATTTCTTCATTCAAATATCTTCTTTTTTTTTATTTAATTATTTAATTAATT
AATTACTTACATACATACTCATCCAGCTACTTATTTATTTTAATTTTCAAATTATTTTAT
TATGATTTTCAAAACAAATTAAAACAAACAAAAAAACATATTTTAATAATATTTTTGAAG
GTACAACAACATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCA
AAATATCACTTCTTTGAATCTCAATGTTAGGTAATTTTGTTAAATATTTATTTGATTAAG
TTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGTAAATAAGTGGTTAATTT
GTTAAGCAAAAGATGCTTTTGATTATGAATGAATCAATTCATTCAATCACTCATTTCTTC
ATTCAAATATCTTCTTTTTTTTTATTTAATTATTTAATTAATTAATTACTTACATACATA
CTCATCCAGCTACTTACTTATTTTAATTTTCAATTTATTTTATTATGATTTTCAAAACAA
ATTCAAACAAACAAAAAAACATATTTTAATAATATTTTTGAAGGGATAATAAGATTGGTG
CAGAAGGAGCAAAACATATTGGAATGAGCTTAGAAAAGTGTCAAAATATCACTTCTTTGA
ATCTCAATCTTGTGTAATTTTGTTAAATATTTATTTGATTAAGTTTGTTAGTTGAAGTTG
TAAAATATGAAAGGAAGTAAAGAAGTAAATAAGTGGTTAATTTGTTAAGCAAAAGATGCT
TTTGATTATGAATGAATCAATTCATTCAATCACTCATTTCTTCATTCAAATATCTTCTTT
TTTTTTATTTAATTATTTAATTAATTAATTACTTACATACATACTCATCCAGCTACTTAC
TTATTTTAATTTTCAATTTATTTTATTATGATTTTCAAAACAAATTCAAACAAACAAAAA
AACATATTTTAATAATATTTTTGAAGGGGAAATGAAATTGGTGCATGGAAATGGAAATGG
AAATACTCGCACATATAATTTTTTGAAATTGGTGCAGAAGGAGCAAAACATATTGGAATG
AGCTTAGAAAAGTGTCAAAATATCACTTCTTTGAATCTCAATCTATGGTAATTTTGTTAA
ATATTTATTTGATTAAGTTTGTTAGTTGAAGTTGTAAAATATGAAAGGAAGTAAAGAAGT
AAATAAGTGGTTAATTTGTTAAGCAAAAGATGCTTTTGATTATGAATGAATCAATTCATT
CAATCACTCATTTCTTCATTCAAATATCTTCTTTTTTTTTATTTAATTATTTAATTAATT
AATTACTTACATACATACTCATCCAGCTACTTACTTATTTTAATTTTCAATTTATTTTAT
TATGATTTTCAAAACAAATTCAAACAAACAAAAAAACATATTTTAATAATATTTTTGAAG
GTACAACAACATTGGTGCAGAAGGAGCAAAACATATTGCAATGAGCTTAGAAAAGTGTCA
AAATATCACTTTTTTCAATTTATATGTGAGGTAGGCTTTTTTTATATAAATATTATATTT
TATTTAAGATTTTTTAATTTAAATTATAAAAATAGAAAGGGAAACAATTTGAATGAAAAA
GCATTTTTAGATTTAAACTAAATTTCTAATAAGCTTTATTAATTATAAAAACTATAGATT
TAATGA