Identifiers and Description

Gene Model Identifier

TTHERM_000837979

Standard Name

CDK21 (Cyclin-Dependent Kinase 21)

Aliases

None

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; cyclin-dependent kinase-like SerineThreonine kinase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_000837979

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07459.26.997194614751282e-100protein kinase domain-containi
ng protein (597 aa)
OxytrichaContig11847.0.g488.002162267243937e-73Protein kinase domain
WormBaseWBGene000127791.0000099287337047e-53status:Partially_confirmed U
niProt:Q9U2H1 protein_id:CAB
63367.1
DictyBaseDDB_G02886772.9994376937714457e-52cdk5 on chromosome: 5 position
1885785 to 1886770
SGDYPL031C1.9991939848149086e-44PHO85 Cyclin-dependent kinase,
with ten cyclin partners; inv
olved in regulating the cellul
ar response to nutrient levels
and environmental conditions
and progression through the ce
ll cycle
Stentor CoeruleusSteCoe_63312.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000837979(coding)
ATGAATAAGTATTAAGTCTTGAGCATACTTGAAGAAGCTGATTATTTTAAACTTTATAAG
TGTCTTAATAAAGAAACATAAAAAATTATAGCTATTAAGGCATACAAATTAAATATCAAC
TAAGTCGAGGAAAAAAAACGGATAGAGAGGGAAGTAAAGATTAAGAAAATGCTACATCAC
AAAAATATAGTTGATATAATTGAAATTTGTTAAAAGAATAATGAAATATACATTGTTGAA
GAGTATGTAGAAATTAGCTTATCAAATTATCTTAAATAGGGAAGTTAATAAAAAGGATTA
GATTAAAATGTCATTCCAAATATAATGTATTAGGTTTTATCATCTATAAATTAGTGTCAC
AAATATGATATTATTCATTAAAATATTAAACCTATGCATATATATATCAATCCTTCAAAT
TATGAGTTAAAATTAAATGGATTTCGTTTAGCTAGATAATTACCTTAAAAAGGTGAAATA
GTTACAGATTATGTAGAAGCAAGATGGTATAAATCACCAGAGTATCTTTTAGATTACAGA
AAATACGGAAAACCGGAAGATATTTGGGCAGCTGCTTGTGTCATGGCAGAATTAATTGAT
GGTGAACCTTTATTTCCTGGTTAAGGAGAAATAGATTAATTTTATAGGATTGTATAGGTG
ATAGGTCCACTTACAAATTAATATGAGAATTTATTCAAAAAAAAATATAAAGATTTAAAA
TTTCCAATTATTAAAAATTTTAATTCTATTGAATTGAGATATCAAGGCAAAATTAATGCT
GAAGGGCTAGATTTAATGAAAATGATGCTTAAAATGAATCCAGACGAAAGAATAACAGCT
GAATAATCTTTAAGTCATCCTTTCTTTGATAAATTAAAATCAAAAATTGATAATGAAAAG
GGAGCTTTTATATAAAATAAATTATCTAATCAAATAAAAGAAAACTTAAAGAATTAAGCT
CACTAGGATTTATAAAAAAATTGA


>TTHERM_000837979(protein)
MNKYQVLSILEEADYFKLYKCLNKETQKIIAIKAYKLNINQVEEKKRIEREVKIKKMLHH
KNIVDIIEICQKNNEIYIVEEYVEISLSNYLKQGSQQKGLDQNVIPNIMYQVLSSINQCH
KYDIIHQNIKPMHIYINPSNYELKLNGFRLARQLPQKGEIVTDYVEARWYKSPEYLLDYR
KYGKPEDIWAAACVMAELIDGEPLFPGQGEIDQFYRIVQVIGPLTNQYENLFKKKYKDLK
FPIIKNFNSIELRYQGKINAEGLDLMKMMLKMNPDERITAEQSLSHPFFDKLKSKIDNEK
GAFIQNKLSNQIKENLKNQAHQDLQKN


>TTHERM_000837979(gene)
ATGAATAAGTATTAAGTCTTGAGCATACTTGAAGAAGCTGATTATTTTAAACTTTATAAG
TGTCTTAATAAAGAAACATAAAAAATTATAGCTATTAAGGCATACAAATTAAATATCAAC
TAAGTCGAGGAAAAAAAACGGATAGAGAGGGAAGTAAAGATTAAGAAAATGCTACATCAC
AAAAATATAGTTGATATAATTGAAATTTGTTAAAAGAATAATGAAATATACATTGTTGAA
GAGTATGTAGAAATTAGCTTATCAAATTATCTTAAATAGGGAAGTTAATAAAAAGGATTA
GATTAAAATGTCATTCCAAATATAATGTATTAGGTTTTATCATCTATAAATTAGTGTCAC
AAATATGATATTATTCATTAAAATATTAAACCTATGCATATATATATCAATCCTTCAAAT
TATGAGTTAAAATTAAATGGATTTCGTTTAGCTAGATAATTACCTTAAAAAGGTGAAATA
GTTACAGATTATGTAGAAGCAAGATGGTATAAATCACCAGAGTATCTTTTAGATTACAGA
AAATACGGAAAACCGGAAGATATTTGGGCAGCTGCTTGTGTCATGGCAGAATTAATTGAT
GGTGAACCTTTATTTCCTGGTTAAGGAGAAATAGATTAATTTTATAGGATTGTATAGGTG
ATAGGTCCACTTACAAATTAATATGAGAATTTATTCAAAAAAAAATATAAAGATTTAAAA
TTTCCAATTATTAAAAATTTTAATTCTATTGAATTGAGATATCAAGGCAAAATTAATGCT
GAAGGGCTAGATTTAATGAAAATGATGCTTAAAATGAATCCAGACGAAAGAATAACAGCT
GAATAATCTTTAAGTCATCCTTTCTTTGATAAATTAAAATCAAAAATTGATAATGAAAAG
GGAGCTTTTATATAAAATAAATTATCTAATCAAATAAAAGAAAACTTAAAGAATTAAGCT
CACTAGGATTTATAAAAAAATTGA