Identifiers and Description

Gene Model Identifier

TTHERM_00784290

Standard Name

CDK18 (Cyclin-Dependent Kinase 18)

Aliases

PreTt25533 | 131.m00106 | 3813.m01608

Description

Protein kinase domain containing protein; sequence similarity to the CDC2 subfamily of the protein kinase CDK family; involved in nuclear formation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00784290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11413.12.998986826334339e-156protein kinase domain-containi
ng protein (337 aa)
OxytrichaContig5189.0.g912.999467474389571e-105Protein kinase domain
WormBaseWBGene000004055.000356947592888e-100locus:cdk-1 Cyclin-dependent
kinase 1 status:Confirmed
UniProt:P34556 protein_id:C
AA81590.1
DictyBaseDDB_G02728131.0003391709219401e-98cdk1 on chromosome: 2 position
2216835 to 2217926
SGDYBR160W3.000425225396195e-97CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
Stentor CoeruleusSteCoe_34978.408597124803643e-50

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000263

Sequences

>TTHERM_00784290(coding)
ATGGCAACTAATATTTTACAATCTTAAGTAAGCTTAGGTCACTAGGAAGATAAAAAATAA
TGCTTTAACGAAATTCCTGATAGGTTTAAATGCTTACAAAAAATTGGAGAGGGAACCTAT
GGTATTGTTTACAAAGGATTTGATACTTAAACCAACACACAAGTAGCTATTAAAAAAGTA
AAATTAGATTAGGAATAAGAAGGTATTCCTCAATCTGCCCTTAGAGAAATTTGTATATTA
AAGGATTTAAGCGACCATTAAAACATTGTCAAATTAAGAGATGTTATATATCAAATTGAG
GAAAGTAAACTATTTCTTGTTTTTGAATATGTTGACTATGATCTAAAGAAGTATTTGGAA
ACTATGAAACATTTAACATAACATGATATAAAATTAATAATGTATCAACTCTTAAACGGT
TTAGATTTTTGTCACTAAAGAAGAATCATTCATAGAGATATTAAACCCTAAAATATACTT
ATTGATAAGGCTGGAAACGTTAAAATAGCAGATTTTGGTCTGGCTAAAACTTTTTAAGTA
CCAAGCAAAACGCTCACTCATGAGGTAGAAACTCTTTGGTACAGACCACCTGAAATTTTA
TTGGGTGTAAAAACTTACTCCTTGGCTATAGATATGTGGAGTATTGGCTGCGTATTCTAT
GAATTGATGGAAAAAAAACCTTTATTTATAAGTGATTCAGAAATAGAAGCCATATTTAAA
ATCTTTTAATTTCATGGTACTCCCAATTCAGAAACATTTTAAGGATTAGAAGATTATCCT
TACTTTAAGTCTACATTCCCTCGTTTCCATGCTTAAGATCCTTTTATAGTATTTAAAAAT
TTAGAAAATGATGCTCGCGACTTACTTATGTAAATGATAGCCCTTAATCCTTTAGACAGA
ATATCAGTAAAGTAAGCTCTTTTGCACCCATATTTCGATAGCCTTACAGAAAGCGAAAAG
ACTGCATATAACTAATATAATACCAACCAATACATGAAATTTTTTTCAATTTGA


>TTHERM_00784290(protein)
MATNILQSQVSLGHQEDKKQCFNEIPDRFKCLQKIGEGTYGIVYKGFDTQTNTQVAIKKV
KLDQEQEGIPQSALREICILKDLSDHQNIVKLRDVIYQIEESKLFLVFEYVDYDLKKYLE
TMKHLTQHDIKLIMYQLLNGLDFCHQRRIIHRDIKPQNILIDKAGNVKIADFGLAKTFQV
PSKTLTHEVETLWYRPPEILLGVKTYSLAIDMWSIGCVFYELMEKKPLFISDSEIEAIFK
IFQFHGTPNSETFQGLEDYPYFKSTFPRFHAQDPFIVFKNLENDARDLLMQMIALNPLDR
ISVKQALLHPYFDSLTESEKTAYNQYNTNQYMKFFSI


>TTHERM_00784290(gene)
ATGGCAACTAATATTTTACAATCTTAAGTAAGCTTAGGTCACTAGGAAGATAAAAAATAA
TGCTTTAACGAAATTCCTGATAGGTTTAAATGCTTACAAAAAATTGGAGAGGGAACCTAT
GGTATTGTTTACAAAGGATTTGATACTTAAACCAACACACAAGTAGCTATTAAAAAAGTA
AAATTAGATTAGGAATAAGAAGGTATTCCTCAATCTGCCCTTAGAGAAATTTGTATATTA
AAGGATTTAAGCGACCATTAAAACATTGTCAAGTAATTTTTTATATTTTATTAATTGATT
ATTATTTTCTTTTCAGCATTTCTTTGCATCATAGCTATGAAAGATATATTTAAATTATAT
TCATTAAATTATGTTCCTTATTAGATTAAGAGATGTTATATATCAAATTGAGGAAAGTAA
ACTATTTCTTGTTTTTGAATATGTTGACTATGATCTAAAGAAGTATTTGGAAACTATGAA
ACATTTAACATAACATGATATAAAAGTAATTTTTTATTACAAGTTGTTAAATTTATTATT
ACTAATTTTTAAAATTTAAAACTAGTTAATAATGTATCAACTCTTAAACGGTTTAGATTT
TTGTCACTAAAGAAGAATCATTCATAGAGATATTAAACCCTAAAATATACTTATTGATAA
GGCTGGAAACGTTAAAATAGCAGATTTTGGTCTGGCTAAAACTTTTTAAGTACCAAGCAA
AACGCTCACTCATGAGGTAGAAACTCTTTGGTACAGACCACCTGAAATTTTATTGGGTGT
AAAAACTTACTCCTTGGCTATAGATATGTGGAGTATTGGCTGCGTATTCTATGAATTGAT
GGAAAAAAAACCTTTATTTATAAGTGATTCAGAAATAGAAGCCATATTTAAAATCTTTTA
ATTTCATGGTACTCCCAATTCAGAAACATTTTAAGGATTAGAAGATTATCCTTACTTTAA
GTCTACATTCCCTCGTTTCCATGCTTAAGATCCTTTTATAGTATTTAAAAATTTAGAAAA
TGATGCTCGCGACTTACTTATGTAAATGATAGCCCTTAATCCTTTAGACAGAATATCAGT
AAAGTAAGCTCTTTTGCACCCATATTTCGATAGCCTTACAGAAAGCGAAAAGACTGCATA
TAACTAATATAATACCAACCAATACATGAAATTTTTTTCAATTTGA