Identifiers and Description

Gene Model Identifier

TTHERM_00066860

Standard Name

CDK17 (Cyclin-Dependent Kinase 17)

Aliases

PreTt13176 | 4.m00575 | 3707.m00213

Description

Protein kinase domain containing protein; Sequence similarity to the PITSLRE subfamily of the protein kinase CDK family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00066860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02086.19.997093137033517e-262protein kinase domain-containi
ng protein (425 aa)
OxytrichaContig21786.0.g1147.00091582959949e-118Protein kinase domain
DictyBaseDDB_G02832799.003233894748109e-95cdk11 on chromosome: 4 positio
n 446640 to 447716
WormBaseWBGene000152033.9984352235938583e-87Putative serine/threonine-prot
ein kinase B0495.2 status:Pa
rtially_confirmed UniProt:Q0
9437 protein_id:CCD61471.1
SGDYKL139W4.000989088096131e-71CTK1 Catalytic (alpha) subunit
of C-terminal domain kinase I
(CTDK-I); phosphorylates both
RNA pol II subunit Rpo21p to
affect transcription and pre-m
RNA 3 end processing, and ribo
somal protein Rps2p to increas
e translational fidelity; simi
lar to the Drosophila dCDK12 a
nd human CDK12 and probably CD
K13
Stentor CoeruleusSteCoe_181972.6786369618080778e-33

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000262

Sequences

>TTHERM_00066860(coding)
ATGTCTGATTAGCAAATAGATAAACAAAGAGAAGAAGCTCACTTTAATGAAAATGAGTCT
TCTGATTCTAACTTTGACCATATAGAAGATAATGAATAGGATGAATAAAAAAATGAAATT
AATTTAAATTTAGATGATGAAGAAAGAAAAATTTTACGTAAGCATTCTTAAGAATTATCA
GCGGAAAAGAAATTATCATTATTACGTAAAAGGAAAATATGCGGTCTTTTAGAAGGATGT
GATTCTGTAGATAATTATTAAAAATTAAATAAAATTCATGAAGGTGTTTATGGTGTTGTA
TATAGAGCTGTCGATAAATTAACTGGAGAAATTATAGCTATTAAAAAAACCAAAATAGAT
CGCAAAAAAGAAAAGGAAGGATTTCCTATCACTTCAATCAGAGAATTTAACATTCTAATG
GCTCTTAGACATGAAAATATAGTAGCTGTAAAAAGAGTTGTGATGGGTACAGATCTAGAT
TCTATATATATGATTATGGAGTACATGGAGCATGAGTTGAAGGATGTTATTGAGAATCAT
CATGATGAATTTTAGGAACCATAAATTAAAAGTCTTGTCTAGTAGCTACTTTTAGGAATG
GATTTTTTATAAAAAAAGAAGATTATGCATAGAGATTTAAAAACTTCAAATATTTTGTAT
AATAATAAGGGGTAATTAAAAATTTGTGATTTTGGTTTAGGTAGAAGATGGCAAGGTAAT
AAGCCTTACACCTTAAATGTAGTTACTATGTGGTATCGTGCACCTGAAGTATTACTAGGC
TAAGATAAGTATACAACTGCTCTAGATATGTGGAGTGTGGGTTGCATTTTTGGTGAACTA
ATAACTAAAGATTAGCTATTTAAAGGAAAAAATGAAACAAACTAAATTGAGTGTATATTC
AATGCCATGGGAGGTCCCACAGAGCGTTCATGGCCTGGCTGGACTGAGTTCAAACATTCT
AAGCTTTTTAAAGATAGAAATTACCCATCAGAATGTACCTTGAATGAAAAAATAGGGAAT
AGAATATCATAAACAGGTTACAAATTATTGTGCTAAATGCTTACTTTAAACCCTAAAGAG
CGTATTACTGCTACAAAAGCACTTCAAGATCCTTGGTTTAAAGAAGAACCTCTTCCTGCA
AAACTAGAAGATATGCCTAAATTCAAACCATTAAATGAAATATCGAGAGAAGAAAGAAAA
AAGTTAAAATTAAATAATTAGCAAGCTTAACAGTAGGCTTAACAATCTCCAATTAAAGAG
TGA


>TTHERM_00066860(protein)
MSDQQIDKQREEAHFNENESSDSNFDHIEDNEQDEQKNEINLNLDDEERKILRKHSQELS
AEKKLSLLRKRKICGLLEGCDSVDNYQKLNKIHEGVYGVVYRAVDKLTGEIIAIKKTKID
RKKEKEGFPITSIREFNILMALRHENIVAVKRVVMGTDLDSIYMIMEYMEHELKDVIENH
HDEFQEPQIKSLVQQLLLGMDFLQKKKIMHRDLKTSNILYNNKGQLKICDFGLGRRWQGN
KPYTLNVVTMWYRAPEVLLGQDKYTTALDMWSVGCIFGELITKDQLFKGKNETNQIECIF
NAMGGPTERSWPGWTEFKHSKLFKDRNYPSECTLNEKIGNRISQTGYKLLCQMLTLNPKE
RITATKALQDPWFKEEPLPAKLEDMPKFKPLNEISREERKKLKLNNQQAQQQAQQSPIKE


>TTHERM_00066860(gene)
ATGTCTGATTAGCAAATAGATAAACAAAGAGAAGAAGCTCACTTTAATGAAAATGAGTCT
TCTGATTCTAACTTTGACCATATAGAAGATAATGAATAGGATGAATAAAAAAATGAAATT
AATTTAAATTTAGATGATGAAGAAAGAAAAATTTTACGTAAGCATTCTTAAGAATTATCA
GCGGAAAAGAAATTATCATTATTACGTAAAAGGAAAATATGCGGTCTTTTAGAAGGATGT
GATTCTGTAGATAATTATTAAAAATTAAATAAAATTCATGAAGGTGTTTATGGTGTTGTA
TATAGAGCTGTCGATAAATTAACTGGAGAAATTATAGCTATTAAAAAAACCAAAATAGAT
CGCAAAAAAGAAAAGGAAGGATTTCCTATCACTTCAATCAGAGAATTTAACATTCTAATG
GCTCTTAGACATGAAAATATAGTAGGTAAACCTTTATTTTATATAATAAGTTGCTTTTTT
ACAAGAATAAATTCAAATTTTAAGTTTTCAAAATAAAAAAATCGCGTCTATTAAAATTAT
ATCAATAAATATCATGATTGATATATAAATAAATATAAGAAAATGAATGAATAATTATAT
TTATGAAGTCTATTTTCTATTTATTTCAATTAATTTTTTTATAAATTTATATAAAGATTT
TTTTAAAATATAGCTGTAAAAAGAGTTGTGATGGGTACAGATCTAGATTCTATATATATG
ATTATGGAGTACATGGAGCATGAGTTGAAGGATGTTATTGAGAATCATCATGATGAATTT
TAGGAACCATAAATTAAAAGTCTTGTCTAGTAGCTACTTTTAGGAATGGATTTTTTATAA
AAAAAGAAGATTATGCATAGAGATTTAAAAACTTCAAATATTTTGTATAATAATAAGGGG
TAATTAAAAATTTGTGATTTTGGTTTAGGTAGAAGATGGCAAGGTAATAAGCCTTACACC
TTAAATGTAGTTACTATGTGGTATCGTGCACCTGAAGTATTACTAGGCTAAGATAAGTAT
ACAACTGCTCTAGATATGTGGAGTGTGGGTTGCATTTTTGGTGAACTAATAACTAAAGAT
TAGCTATTTAAAGGAAAAAATGAAACAAACTAAATTGAGTGTATATTCAATGCCATGGGA
GGTCCCACAGAGCGTTCATGGCCTGGCTGGACTGAGTTCAAACATTCTAAGCTTTTTAAA
GATAGAAATTACCCATCAGAATGTACCTTGAATGAAAAAATAGGGAATAGAATATCATAA
ACAGGTTACAAATTATTGTGCTAAATGCTTACTTTAAACCCTAAAGAGCGTATTACTGCT
ACAAAAGCACTTCAAGATCCTTGGTTTAAAGAAGAACCTCTTCCTGCAAAACTAGAAGAT
ATGCCTAAATTCAAACCATTAAATGAAATATCGAGAGAAGAAAGAAAAAAGTTAAAATTA
AATAATTAGCAAGCTTAACAGTAGGCTTAACAATCTCCAATTAAAGAGTGA