Identifiers and Description

Gene Model Identifier

TTHERM_00394590

Standard Name

CDK14 (Cyclin-Dependent Kinase 14)

Aliases

PreTt23583 | 42.m00317 | 3813.m01536

Description

Protein kinase domain containing protein; sequence similarity to the CDC2 subfamily of the protein kinase CDK family; involved in chromosome pairing and completion of meiosis I

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00394590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11538.19.997093137033517e-262protein kinase domain-containi
ng protein (340 aa)
SGDYBR160W1.0003292389192957e-45CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
DictyBaseDDB_G02886773.00039543526891e-44cdk5 on chromosome: 5 position
1885785 to 1886770
OxytrichaContig21128.0.g795.001531130907917e-44Protein kinase domain
WormBaseWBGene000004088.997878368889416e-41locus:cdk-7 status:Confirmed
UniProt:G5EFV5 protein_id
:CCD69307.1
Stentor CoeruleusSteCoe_255545.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:SUPR000265

Sequences

>TTHERM_00394590(coding)
ATGGATGTTTAGCAAAAGAGAAAAGTTTATAACTAAAAGTATTTGAGAATTAAAAAGATC
AATGAGGGTTCATTTGGCAAAATTATCCTCTGCGAGCTTGTTGACTAAAAGGGTTAATAT
TGTGTATTGAAGAAGTTCAAGGTCACCTAATAGAGTGCTATTGATGAGTTAAGTATAAAG
GAAATCTATTACATGAAAAAACTTGATCATCCTAATTTAGTCAAATCTGATGATATTTTC
AAAATTAAAAAATCCTACAATGGCTAAGATTTCTTCGAATAACTTTACATGCATCTTCCT
TATTATTTGGAAATGTCAGAAGTCCCTAGAGAAAATTTATCTGTAGAAGCAATCAAAATA
TTAATCAAGCAATTAATTGAAGCTGTTCATTTCCTTCACCAAAAGAAAATTATTCATAGA
GACATCAAGCCCAGTAACATATTTTTAGACAAAACTGGAAAACTTTTATTAGGTGATATG
GGTATTTCTAGAGATTTCCCTGAAAATAAAGACTAAGAATTAACAGGAAATACAATCACT
CGTTTGTACAGACCTCCAGAAATTCTATTTGGATGCAAAAAATATAATGAAACTGTTGAT
CTATGGTCACTTGGTTGCACTATCGCAGAATTTTTCATGGATCACAAAAAATACTTCTTT
TAAGGAAAGAGTGAAATAGATCAACTATGTAAAGTTTTTGAAATTAGAGGTTCTGCTAAT
GAATAGAACTGGCCAGGCTGTACTGAGCTCCCCTATTATATGGATTTTGGAGAATTAAAT
TAAAAGGACTTAAGCTCTTTACTACCAAAAGCTCCTAAAGAATGCATAGAAATAATAGAC
TCTTTGCTATAGTTGTGTCCTCAAAAGAGAGCTAAAATCGAAGATATTATTTAGAATAAA
TGGCTTTAATCAACCACTGAATAAGGATTTTAAGAGCTAAAATAATTTGCTGAAAATAAT
ATATAATCTAATATTCATAAAATTTTACATCCTCCTGAAAGATTTTGA


>TTHERM_00394590(protein)
MDVQQKRKVYNQKYLRIKKINEGSFGKIILCELVDQKGQYCVLKKFKVTQQSAIDELSIK
EIYYMKKLDHPNLVKSDDIFKIKKSYNGQDFFEQLYMHLPYYLEMSEVPRENLSVEAIKI
LIKQLIEAVHFLHQKKIIHRDIKPSNIFLDKTGKLLLGDMGISRDFPENKDQELTGNTIT
RLYRPPEILFGCKKYNETVDLWSLGCTIAEFFMDHKKYFFQGKSEIDQLCKVFEIRGSAN
EQNWPGCTELPYYMDFGELNQKDLSSLLPKAPKECIEIIDSLLQLCPQKRAKIEDIIQNK
WLQSTTEQGFQELKQFAENNIQSNIHKILHPPERF


>TTHERM_00394590(gene)
ATGGATGTTTAGCAAAAGAGAAAAGTTTATAACTAAAAGTATTTGAGAATTAAAAAGATC
AATGAGGGTTCATTTGGCAAAATTATCCTCTGCGAGCTTGTTGACTAAAAGGGTTAATAT
TGTGTATTGAAGAAGTTCAAGGTCACCTAATAGAGTGTATAAATAAATATTCTGATTATA
GTTTTAAAATAATTTATGATATTAAAAGGCTATTGATGAGTTAAGTATAAAGGAAATCTA
TTACATGAAAAAACTTGATCATCCTAATTTAGTCAAAGTAATTAATAATACTGGTTTTAA
ATTGTTAGCCAATTTTATCATTTTTAAATAACAGTCTGATGATATTTTCAAAATTAAAAA
ATCCTACAATGGCTAAGATTTCTTCGAATAACTTTACATGCATCTTCCTTATTATTTGGA
AATGTCAGAAGTCCCTAGAGAAAATTTATCTGTAGAAGCAATCAAAATATTAATCAAGCA
ATTAATTGAAGCTGTTCATTTCCTTCACCAAAAGAAAATTATTCATAGAGTATTTGCTTA
ATTATTTGGATAAGTTTTTGTTTATTTAATACATATAATAAAAAATAAAGGACATCAAGC
CCAGTAACATATTTTTAGACAAAACTGGAAAACTTTTATTAGGTGATATGGGTATTTCTA
GAGATTTCCCTGAAAATAAAGACTAAGAATTAACAGGAAATACAATCACTCGTTTGTACA
GACCTCCAGAAATTCTATTTGGATGCAAAAAATATAATGAAACTGTTGATCTATGGTCAC
TTGGTTGCACTATCGCAGAATTTTTCATGGATCACAAAAAATACTTCTTTTAAGGAAAGA
GTGAAATAGATCAACTATGTAAAGTTTTTGAAATTAGAGGTTCTGCTAATGTAAATTATC
TATTTATTGATATAACTCTAATTTCAATTATAATATCAAATATATATTTAAAAATCAGGA
ATAGAACTGGCCAGGCTGTACTGAGCTCCCCTATTATATGGATTTTGGAGAATTAAATTA
AAAGGACTTAAGCTCTTTACTACCAAAAGCTCCTAAAGAATGCATAGAAATAATAGACTC
TTTGCTATAGTTGTGTCCTCAAAAGAGAGCTAAAATCGAAGATGTAAATAAAAATAATTA
TATTTAAAATTAAATTAATAACTTAATTCAAAACATTAATTTATAAATTAGATTATTTAG
AATAAATGGCTTTAATCAACCACTGAATAAGGATTTTAAGAGCTAAAATAATTTGCTGAA
AATAATATATAATCTAATATTCATAAAATTTTACATCCTCCTGAAAGATTTTGA