Identifiers and Description

Gene Model Identifier

TTHERM_00576780

Standard Name

CDK11 (Cyclin-Dependent Kinase 11)

Aliases

PreTt28969 | 77.m00181 | 3812.m02656

Description

Protein Kinase family protein; involved in meiosis I completion

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00576780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04037.19.997093137033517e-262hypothetical protein (583 aa)
OxytrichaContig15886.0.g146.000667945664035e-116Protein kinase domain
DictyBaseDDB_G02680784.997910161537908e-106DDB_G0268078 on chromosome: 1
position 1417972 to 1419590
WormBaseWBGene000011211.0002646133906571e-103locus:dyf-5 status:Confirmed
UniProt:B3WFY8 protein_id
:CAQ76489.2
SGDYBR160W1.0000099287337047e-53CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
Stentor CoeruleusSteCoe_228205.665668176358939e-52

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000258

Sequences

>TTHERM_00576780(coding)
ATGGACAAGTACTAATTGGTTAAAAATCTTGGAGATGGCACCTATGGAACAGTATTCAAG
GCTATCAATAAAGAAAATGGTGAAATTGTTGCTATCAAAAAAATGAAAAGAAAGTATAGA
AATTGGGACGAGTGCATGTCTCTGAGGGAAGTTAAATCGTTACGTAAAATGAATCACCCA
AATCTTGTCAAGCTAAAAGAAGTCCTCTAGATAAAAGACGAGCTTATGCTTGTTTTTGAG
TATGTAGATCTCAATTTATACTAAATGTACATGACTTACAAAGAGAAGAAAACTTAAATT
CCTGAGTCTGTTATAAAAAAAATAATTTATCAAATAGCGTTAGGCTTGGATTCACTGCAT
AACACAGGATACTTTCATAGGGATCTTAAGCCTGAAAATCTATTGGTTAACATGTCATCA
TTAAACGTAAAAGTTTGCGACTTTGGACTTGCAAGGGAGGTTAGATGCCGTCCTCCTTTT
ACTGAATACGTCTCTACTAGATGGTACAGAGCACCAGAAATACTTTTACATAGCTAGAAT
TATAATTCTCCGATTGATGTATTTGCTTTAGGGTGCATTATGGCGGAATTATATAATCTT
CAGCCATTATTTTCAGGTTAAAATGAAGTAGATTAATTTTATAAAATAGTAAGTGTATTA
GGCACACCTTAAAATTGGAATGAAGGAGCTAAATTAGCCCAAAAACTGTAGTTAACAATA
CCTAAAAAGGAGCCATTGCCTTTACCATAAGTAGTGCCTAGAGCTTCTCTTGATGCACTT
TAACTTCTAGGTGATATGCTGCAATATGATCCAATGAAACGTCCTACAGCAATTTAAATT
ACAAAATATCCTTATTTTGATGATATAAGAAAAGAAAATTCAGATAGTGGAAGCTAAGTT
TTTAGTCATTCTAACCTGCAAGAAGCACACTCAGGAAATGCATTAACTTAACAAAAATCT
AATCACACATTAAGCATTACAAATATTCCTAATAAAGTTAGCGAGAATGCTTATAAAGAA
ATAAAGAATCCATGGTTTGTAAACAATTAGTAATCATATTAATAACAGTAATCAGTTTTA
AATGAAAATAATTTTGCTAAAAAGTAAAATACCCAATCATATCAAAGCTTCAATACTCTT
AATTTAAGTAAGCCTTAAAATCCTTTCTAACAGTATAAAGATGAATTTTTAAAAAACTAA
AATATCTACTCTAAACAGCATGTATAAGATTCTAATTATGCTAAGAGAGCTGCAAATTAA
TTATTATATGAGTAGTAGTAATCATAGTAAAACCTTAATCCTGCTTCAACTACTAACTAC
CATTTTGCAAGTAAGTCGAATTTAAATGGAGCTTAGAACTCTGGATTACCGTTTGGAGGA
ACATTAGAAAGACCTCTTAATTTTAACAATTAATATGATCTTTAGAAAGTGAACAGAAGA
TAAAATAATTTGCTGAAAAAGAATTATGAGAATTTTAACTCTATTCAATCTAACAATGAA
CCATAATATTTCAATCAACAAAAATATAGTGATTTATAGAGCTCATTAGACAATCAAGCA
GCAGCTTTTTTCAATTAATTTAATAAAGTTTAGGTTAGCAATAATAACTATTAAAATTAC
CATAACAATAAGAACTCTTCTTTGCCACCAGAATATAGAAATGTCAATAATGAAGCTGAA
TCTTAATAACTGAATAAAATGTTTGAAGATAAGCTAAATTGGGCATTTTGA


>TTHERM_00576780(protein)
MDKYQLVKNLGDGTYGTVFKAINKENGEIVAIKKMKRKYRNWDECMSLREVKSLRKMNHP
NLVKLKEVLQIKDELMLVFEYVDLNLYQMYMTYKEKKTQIPESVIKKIIYQIALGLDSLH
NTGYFHRDLKPENLLVNMSSLNVKVCDFGLAREVRCRPPFTEYVSTRWYRAPEILLHSQN
YNSPIDVFALGCIMAELYNLQPLFSGQNEVDQFYKIVSVLGTPQNWNEGAKLAQKLQLTI
PKKEPLPLPQVVPRASLDALQLLGDMLQYDPMKRPTAIQITKYPYFDDIRKENSDSGSQV
FSHSNLQEAHSGNALTQQKSNHTLSITNIPNKVSENAYKEIKNPWFVNNQQSYQQQQSVL
NENNFAKKQNTQSYQSFNTLNLSKPQNPFQQYKDEFLKNQNIYSKQHVQDSNYAKRAANQ
LLYEQQQSQQNLNPASTTNYHFASKSNLNGAQNSGLPFGGTLERPLNFNNQYDLQKVNRR
QNNLLKKNYENFNSIQSNNEPQYFNQQKYSDLQSSLDNQAAAFFNQFNKVQVSNNNYQNY
HNNKNSSLPPEYRNVNNEAESQQLNKMFEDKLNWAF


>TTHERM_00576780(gene)
ATGGACAAGTACTAATTGGTTAAAAATCTTGGAGATGGCACCTATGGAACAGTATTCAAG
GCTATCAATAAAGAAAATGGTGAAATTGTTGCTATCAAAAAAATGAAAAGAAAGTATAGA
AATTGGGACGAGTGCATGTCTCTGAGGGAAGTTAAATCGTTACGTAAAATGAATCACCCA
AATCTTGTCAAGCTAAAAGAAGTCCTCTAGATAAAAGACGAGCTTATGCTTGTTTTTGAG
TATGTAGATCTCAATTTATACTAAATGTACATGACTTACAAAGAGAAGAAAACTTAAATT
CCTGAGTCTGTTATAAAAAAAATAATTTATCAAATAGCGTTAGGCTTGGATTCACTGCAT
AACACAGGATACTTTCATAGGGATCTTAAGCCTGAAAATCTATTGGTTAACATGTCATCA
TTAAACGTAAAAGTTTGCGACTTTGGACTTGCAAGGGAGGTAAGAGATAATTATATATAA
CAAATAGAATAAATAAGCTAAACACCCTTAACTATAAATTTCACCAGTTTTATAAAAATT
TAAAGCTGCTGATTTTCACTTCTTTGAAATCCTAAAAATGGCTTAAATAATAAAGAAAAG
TAGCTTACTAAAATGAATAAAACATGTGAACACAAATAAATATTTAAATCCCTCTTAAAA
ATTCTAAATTTTTTGTTATGTTTTAAACTAACGTTCAATTTTTTTTTTTTCGCGACGAAT
TTATTCCAGTCTTCTAATTTGTTCGAATATACAATGATGCGCGATATTATTTTTATTAAT
ATCAAGTAAATGAAGCCTTACAGTAATACTTACAAGAACTTATATTTTTGTAAATTATTT
TTTCCAGTACTTGAAGAGGATAAAAATTATCAATAATAATGCTCTTTCAAGCATTGATAG
CATATTTTTTATTCCTCAATTCAATATTTTGTTTAATTGTCGTAATTCATATCCTTGCTG
GTTCTACTACCTATAAAACTCCCATCATTTTTAAAATTAGAATCATTCATTTGAAAGCTC
TTAATATTTTTAAAAGAAAGAGGATTTATTTAAATATATCAATCCTTAAATGATATTTTA
AATAAAGACTCTAATTTATAATGAATTATAAAAATACTTTGATTACTACCATAAATTTAT
TCAAATACTTTTTGTTACATCTGGATTAATGATTCTCTTTTGTGGTCAAAATTAATTCAT
AGTGTTTTATTTTTAAATATTTATTAAACAAAATTGTAATTTTGACCATAGAATTAATCC
CAATTTTTTAATTTATTTATTTTATAATTAATATTATTGCAGGTTAGATGCCGTCCTCCT
TTTACTGAATACGTCTCTACTAGATGGTACAGAGCACCAGAAATACTTTTACATAGCTAG
AATTATAATTCTCCGATTGATGTATTTGCTTTAGGGTGCATTATGGCGGAATTATATAAT
CTTCAGCCATTATTTTCAGGTTAAAATGAAGTAGATTAATTTTATAAAATAGTAAGTGTA
TTAGGCACACCTTAAAATTGGAATGAAGGAGCTAAATTAGCCCAAAAACTGTAGTTAACA
ATACCTAAAAAGGAGCCATTGCCTTTACCATAAGTAGTGCCTAGAGCTTCTCTTGATGCA
CTTTAACTTCTAGGTGATATGCTGCAATATGATCCAATGAAACGTCCTACAGCAATTTAA
ATTACAAAATATCCTTATTTTGATGATATAAGAAAAGAAAATTCAGATAGTGGAAGCTAA
GTTTTTAGTCATTCTAACCTGCAAGAAGCACACTCAGGAAATGCATTAACTTAACAAAAA
TCTAATCACACATTAAGCATTACAAATATTCCTAATAAAGTTAGCGAGAATGCTTATAAA
GAAATAAAGAATCCATGGTTTGTAAACAATTAGTAATCATATTAATAACAGTAATCAGTT
TTAAATGAAAATAATTTTGCTAAAAAGTAAAATACCCAATCATATCAAAGCTTCAATACT
CTTAATTTAAGTAAGCCTTAAAATCCTTTCTAACAGTATAAAGATGAATTTTTAAAAAAC
TAAAATATCTACTCTAAACAGCATGTATAAGATTCTAATTATGCTAAGAGAGCTGCAAAT
TAATTATTATATGAGTAGTAGTAATCATAGTAAAACCTTAATCCTGCTTCAACTACTAAC
TACCATTTTGCAAGTAAGTCGAATTTAAATGGAGCTTAGAACTCTGGATTACCGTTTGGA
GGAACATTAGAAAGACCTCTTAATTTTAACAATTAATATGATCTTTAGAAAGTGAACAGA
AGATAAAATAATTTGCTGAAAAAGAATTATGAGAATTTTAACTCTATTCAATCTAACAAT
GAACCATAATATTTCAATCAACAAAAATATAGTGATTTATAGAGCTCATTAGACAATCAA
GCAGCAGCTTTTTTCAATTAATTTAATAAAGTTTAGGTTAGCAATAATAACTATTAAAAT
TACCATAACAATAAGAACTCTTCTTTGCCACCAGAATATAGTAATTTAATTTCTTTTTAT
TATTTTATTAATTTATTTTATTAAATAGGAAATGTCAATAATGAAGCTGAATCTTAATAA
CTGAATAAAATGTTTGAAGATAAGCTAAATTGGGCATTTTGA