Identifiers and Description

Gene Model Identifier

TTHERM_00411810

Standard Name

CDK1 (Cyclin-Dependent protein Kinase)

Aliases

PreTt21599 | 44.m00266 | 3714.m00112

Description

Cyclin-dependent protein kinase; localizes to domains associated with mature basal bodies of ciliary rows and to both the polykineties and haplokinety of the oral apparatus; partial knockout implicates this CDK in chromatin condensation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00411810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10370.19.997093137033517e-262protein kinase domain-containi
ng protein (319 aa)
OxytrichaContig5189.0.g911.0003068573148812e-127Protein kinase domain
DictyBaseDDB_G02886773.0009992673984943e-111cdk5 on chromosome: 5 position
1885785 to 1886770
WormBaseWBGene000004051.0003602942354155e-110locus:cdk-1 Cyclin-dependent
kinase 1 status:Confirmed
UniProt:P34556 protein_id:C
AA81590.1
SGDYBR160W1.9992560499818233e-109CDC28 Catalytic subunit of the
main cell cycle cyclin-depend
ent kinase (CDK); alternately
associates with G1 cyclins (CL
Ns) and G2/M cyclins (CLBs) wh
ich direct the CDK to specific
substrates
Stentor CoeruleusSteCoe_191152.572209372642415e-56

General Information

Paragraph NoGene NameParagraph Text
3CDK1Cyclin-dependent kinases (cdks) are a family of serine-threonine kinases that are involved in cell cycle control and cell division in eukaryotes. Cdks are catalytic subunits that are activated by association with proteins called cyclins, forming cyclin-cdk complexes. Cdk kinase activity is regulated by cyclin binding, phosphorylation and dephosphorylation, protein degradation, protein-protein interactions with cdk inhibitors, and subcellular localization.
4CDK1Tetrahymena thermophila Cdk1p shares homology with cdk homologs from other eukaryotes. It contains 11 catalytic domains characteristic of protein kinases, conserves all of the regulatory phosphorylation sites found in cdks, and has a slightly modified cyclin-binding PSTAIRE motif that is a hallmark of cdks. The Tetrahymena thermophila Cdk1p was also found to bind Saccharomyces cerevisiae p13suc1, a yeast cyclin.
5CDK1The level of Cdk1p fluctuates over the vegetative cell cycle, correlating with its histone H1 kinase activity. Cdk1p is associated with the basal bodies of the ciliary rows of the cell cortex and the oral apparatus. This localization, along with the phenotype of a partial CDK1 knockout phenotype of bent and buckled ciliary rows, suggests that Cdk1p is involved in cortical morphogenesis.

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:12183062: Zhang H, Huang X, Tang L, Zhang QJ, Frankel J, Berger JD (2002) A cyclin-dependent protein kinase homologue associated with the basal body domains in the ciliate Tetrahymena thermophila. Biochimica et biophysica acta 1591(1-3):119-128
  3. Ref:12045216: Doree M and Hunt T (2002) From Cdc2 to Cdk1: when did the cell cycle kinase join its cyclin partner? J Cell Sci 115(Pt 12):2461-4
  4. Ref:10329641: Mizzen CA, Dou Y, Liu Y, Cook RG, Gorovsky MA, Allis CD (1999) Identification and mutation of phosphorylation sites in a linker histone. Phosphorylation of macronuclear H1 is not essential for viability in tetrahymena. The Journal of biological chemistry 274(21):14533-6
  5. Ref:8995382: Sweet MT, Carlson G, Cook RG, Nelson D, Allis CD (1997) Phosphorylation of linker histones by a protein kinase A-like activity in mitotic nuclei. The Journal of biological chemistry 272(2):916-23
  6. Ref:9442875: Morgan DO (1997) Cyclin-dependent kinases: engines, clocks, and microprocessors. Annu Rev Cell Dev Biol 13:261-91
  7. Ref:7958616: Doree M and Galas S (1994) The cyclin-dependent protein kinases and the control of cell division. FASEB J 8(14):1114-21
  8. Ref:2065655: Roth SY, Collini MP, Draetta G, Beach D, Allis CD (1991) A cdc2-like kinase phosphorylates histone H1 in the amitotic macronucleus of Tetrahymena. The EMBO journal 10(8):2069-75

Sequences

>TTHERM_00411810(coding)
ATGAACAATAATACATTTGGCTCAGACAGATATGAAAAGCTACTTAAAGTAGGTGAAGGA
ACATATGGTGAAGTTTACAAGGCTAAAGACATTCAAAGCTCTGAAATTGTTGCTTTGAAG
AAGATTAAATTAGAAAATGAAGATGAAGGTGTCCCTTCAACTGCTCTAAGAGAAATTTCA
ATACTTAAAGAGTTACAACCACATCCCAACATCGTTTGCATGCATGAAGTTATTTATCAA
CCCTAAGAGAAGAAGTTATACCTTGTATTTGAATTTGTTGACTAAGACCTTAAAAAATTC
TTAGACTAATACCGCAAAGATAAAAAACTTTAACTTCGTCCTTACCAAATCAAACTCATG
ATGTATCAAATTTTGAATGGATTGAATTTCTGCCACAGCCGTAGAATTATTCATAGAGAT
TTAAAACCCTAAAACATTTTAATTGATGCTAAGGGAAATATTAAGATTGCTGATTTTGGT
TTGGCTAGAGCATTTGGTGTTCCTATCAAGACTCTTACTCATGAAGTTGAAACTCTTTGG
TACAGAGCTCCCGAAATTCTTTTAGGCTAAAAGGCTTATAGTCTCGGAGTTGATATTTGG
AGTTTGGGTTGCATCTTCCACGAAATGGTTGAAAAGAGAGCTCTCTTCATGGGTGACTCT
GAAATTGATTAAATATTTAAAATATTCTAATACCATGGTACTCCTACTGAGTAGACATGG
CCTGCTTTGAAGGAATGTCCTTACTTTAAACCTATATATCCTCGTTTCAAAACTGCTGAT
CCTAAGACTTACTTTAAGAATTTCTGCGATAAAGGATTTGACCTTATTTAATAGATGATT
GCTCTTGACCCTGCTAAAAGAATATCAGTAAAGGATGCTCTCAGACATCCCTACTTTGAA
GATCTTAGCAGAGAAGATATAGCTAAATTTGAGCCTAATTAAGTTCATATGTACTGA


>TTHERM_00411810(protein)
MNNNTFGSDRYEKLLKVGEGTYGEVYKAKDIQSSEIVALKKIKLENEDEGVPSTALREIS
ILKELQPHPNIVCMHEVIYQPQEKKLYLVFEFVDQDLKKFLDQYRKDKKLQLRPYQIKLM
MYQILNGLNFCHSRRIIHRDLKPQNILIDAKGNIKIADFGLARAFGVPIKTLTHEVETLW
YRAPEILLGQKAYSLGVDIWSLGCIFHEMVEKRALFMGDSEIDQIFKIFQYHGTPTEQTW
PALKECPYFKPIYPRFKTADPKTYFKNFCDKGFDLIQQMIALDPAKRISVKDALRHPYFE
DLSREDIAKFEPNQVHMY


>TTHERM_00411810(gene)
ATGAACAATAATACATTTGGCTCAGACAGATATGAAAAGCTACTTAAAGTAGGTGAAGGA
ACATATGGTGAAGTTTACAAGGCTAAAGACATTCAAAGCTCTGAAATTGTTGCTTTGAAG
AAGATTAAATTAGAAAATGAAGATGAAGGTGTCCCTTCAACTGCTCTAAGAGAAATTTCA
ATACTTAAAGAGTTACAACCACATCCCAACATCGTTTGGTAAAATTTTATTTCTCATAAC
TAAAGCGATTATTTATATTTTGTTCCTGCAATTCTCTTCAATCTTCAATTAGTACCACAC
TTTGTTTGCTACCAAATTAGTTAGTTAAAAATAATTCAAAATTTTAATGAATCCATTTTG
AAAAGATAAACTTTTGAGTTTAACAAAATTGACTGTATTTTTTATAAGATAATAGCAATT
TAGAAAAAGAGAAGAATTTATTTATTTGCCATGTTTTAATTATTTTATTTATATAATAAT
AGCATGCATGAAGTTATTTATCAACCCTAAGAGAAGAAGTTATACCTTGTATTTGAATTT
GTTGACTAAGACCTTAAAAAATTCTTAGACTAATACCGCAAAGATAAAAAACTTTAACTT
CGTCCTTACCAAATCAAAGTAAACAAATAAACTACATTCAAAAATAGTTTTTTTTTTTAA
TTTCAAAAATACCTTCTATATAATCTACCATAGAACACATGCATTCAAGCACGCAAATTA
ATTAGAAATTAGATGATCTTAATTCAATTAGCTTAAAAAAATATTATTTAAATAATTCGA
ATTCAAATAAACAGATTATCTTATTGTTTGATATTTTTATTCAATTTGAAAAAAAAGCAA
CAAAAGATTTTCAAATTAATTATCAATATATTTTGAAACATAACAATCCTTCACTCACTC
ACTCACTTTCTAACATACGCGTTAAATAAATGAATCATAGATCAATCAACTATTAAACTT
TCAATACTAAATTGGTGCAATTCTCCATTTTATTTAGTATTAAATTTAAAGTAAATGCCA
AAAATAAATAATGAGAATTTATTCTTTGATACTAAAATGAATTTATTACAAAAAAATTAG
ATAGAAATGATTTTGAAATACTTTGAAATGTTAATAAAATAAAAACTAATTTCGGTTAAA
AAATAATATATTTTATAATAATAGCTCATGATGTATCAAATTTTGAATGGATTGAATTTC
TGCCACAGCCGTAGAATTATTCATAGAGATTTAAAACCCTAAAACATTTTAATTGATGCT
AAGGGAAATATTAAGATTGCTGATTTTGGTTTGGCTAGAGCATTTGGTGTTCCTATCAAG
ACTCTTACTCATGAAGTTGAAACTCTTTGGTACAGAGCTCCCGAAATTCTTTTAGGCTAA
AAGGCTTATAGTCTCGGAGTTGATATTTGGAGTTTGGGTTGCATCTTCCACGAAATGGTT
GAAAAGAGAGCTCTCTTCATGGGTGACTCTGAAATTGATTAAATATTTAAAATATTCTAA
TACCATGGTACTCCTACTGAGTAGACATGGCCTGCTTTGAAGGAATGTCCTTACTTTAAA
CCTATATATCCTCGTTTCAAAACTGCTGATCCTAAGACTTACTTTAAGAATTTCTGCGAT
AAAGGATTTGACCTTATTTAATAGATGATTGCTCTTGACCCTGCTAAAAGAATATCAGTA
AAGGATGCTCTCAGACATCCCTACTTTGAAGATCTTAGCAGAGAAGATATAGCTAAATTT
GAGCCTAATTAAGTTCATATGTACTGA