Identifiers and Description

Gene Model Identifier

TTHERM_00760490

Standard Name

CDC73 (Cell division cycle 73)

Aliases

PreTt18534 | 125.m00098 | 3672.m00031

Description

member of S.cerevisiae PAF complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05179 ) RNA pol II accessory factor,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00760490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18987.19.997093137033517e-262hypothetical protein (395 aa)
Stentor CoeruleusSteCoe_1205.242885663363464e-22
DictyBaseDDB_G02748852.9990241513684e-21cdc73 on chromosome: 2 positio
n 4342175 to 4344320
OxytrichaContig3758.0.2.g532.99851380290819e-19RNA pol II accessory factor, C
dc73 family
SGDYLR418C7.9993595954329e-16CDC73 Component of the Paf1p c
omplex; binds to and modulates
the activity of RNA polymeras
es I and II; required for expr
ession of certain genes, modif
ication of some histones, and
telomere maintenance; involved
in transcription elongation a
s demonstrated by the G-less-b
ased run-on (GLRO) assay
WormBaseWBGene000180649.997764199084386e-16status:Partially_confirmed U
niProt:Q9N5U5 protein_id:CCD
70582.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00760490(coding)
ATGATAAGAAACAAAAGGCCTAATAAAATAGATCCTTTAGAATTATTAAGGGAGTTCACA
ATAAATAAAAAGGATGTGGTTAAGAAGGATTAGTATTTATTTTTTGATCAAACCAAACTA
GAGTTAAAAACTCCTACTGCATGGAAGAAGAACACTGGCGGATATTACACTTTGGGAGAT
TTGTGGCTTTTCAATCAAAAGGTTTAGCAAAATATGTCTATGAAACATTATTTCAATTAG
CGTTAATCGTTCGCTCTTGAAGGTATTGACAAAATTGATGAAGATGAAATCAGCAACTAT
TTATAAGGAAAAATTGACAATTCAGATAAAATAGATTAGGAAGCAAAGCAATAGCTTCTT
TCTTCAAGAAAAAGTAAACCAGCAGAATCTTCAGCATTAGAAGGATCTTTGACCAAAAAA
ATTAAAACAAATGATGGAGAAGCAAAGACAGTCGAAATGTAATAAAGAGAAGAATATTTA
AATGCAATTAGTTGGATTATGAAAACTGAAAAGCCACTGACATCTAGAACTCGTATGTTG
AGAAGCAAGTTTAATTCTAACATAAACTTCAAGCATTATATTAAGTAACTTGATGAAGGC
AAGATGACAACTTAAAATAATCCTTTAGAAATAAAATCTACTATTAATTATCCTTGTTTA
TTCAAAGATTTGAGAGATAAGGGTTTAAAGCCTATTATTGTTGTTCCTACTATGGGTAGA
ACAGGAAATATTTCACTATTTAATGCCAAAAAATTCTTAGCAGAAGGTAAATATGAAGAT
CCTGAAAATAAAGATTCTGATAACAGTGAAAGAGTCATTTAAATCGAAAAGAATATAAAG
GGACACAATTTCCTTTTCGAAGTCTACGATAATGTTGGTACATTTGAATCCAAAAATAAT
CCTTCACAAAAATCTAAATGGGAGAGAGTTGTCGGTGTGTTCGTTAGTGGTTAAAAATAT
CAATTCAAAGGATGGCCTAAAGAAGATAATATTCCCAGTATCTTAGATTAAGTTAAAGGC
TTCTATTTAAAATACTACGATATTCCTACTCCAGATTAAGTTGCAAATTGGAATGTTAAA
ATTGTATCAGTATATCGTAATAAAAGACATTTAGATTTCCCAGCTTATGAATAATTTTGG
TAGGAGCTAGAAAATTTTATGATTCAACCAAGAAACAAATAAAAATGA


>TTHERM_00760490(protein)
MIRNKRPNKIDPLELLREFTINKKDVVKKDQYLFFDQTKLELKTPTAWKKNTGGYYTLGD
LWLFNQKVQQNMSMKHYFNQRQSFALEGIDKIDEDEISNYLQGKIDNSDKIDQEAKQQLL
SSRKSKPAESSALEGSLTKKIKTNDGEAKTVEMQQREEYLNAISWIMKTEKPLTSRTRML
RSKFNSNINFKHYIKQLDEGKMTTQNNPLEIKSTINYPCLFKDLRDKGLKPIIVVPTMGR
TGNISLFNAKKFLAEGKYEDPENKDSDNSERVIQIEKNIKGHNFLFEVYDNVGTFESKNN
PSQKSKWERVVGVFVSGQKYQFKGWPKEDNIPSILDQVKGFYLKYYDIPTPDQVANWNVK
IVSVYRNKRHLDFPAYEQFWQELENFMIQPRNKQK


>TTHERM_00760490(gene)
ATGATAAGAAACAAAAGGCCTAATAAAATAGATCCTTTAGAATTATTAAGGGAGTTCACA
ATAAATAAAAAGGATGTGGTTAAGAAGGATTAGTATTTATTTTTTGATCAAACCAAACTA
GAGTTAAAAACTCCTACTGCATGGAAGAAGAACACTGGCGGATATTACACTTTGGGAGAT
TTGTGGCTTTTCAATCAAAAGGTTTAGCAAAATATGTCTATGAAACATTATTTCAATTAG
CGTTAATCGTTCGCTCTTGAAGGTATTGACAAAATTGATGAAGATGAAATCAGCAACTAT
TTATAAGGAAAAATTGACAATTCAGATAAAATAGATTAGGAAGCAAAGCAATAGCTTCTT
TCTTCAAGAAAAAGTAAACCAGCAGAATCTTCAGCATTAGAAGGATCTTTGACCAAAAAA
ATTAAAACAAATGATGGAGAAGCAAAGACAGTCGAAATGTAATAAAGAGAAGAATATTTA
AATGCAATTAGTTGGATTATGAAAACTGAAAAGCCACTGACATCTAGAACTCGTATGTTG
AGAAGCAAGTTTAATTCTAACATAAACTTCAAGCATTATATTAAGGTATATGTCCAAAGC
AAGATGCTTATTCATTCTATGAAAAAATAGCTTTTAGAAAGCCTTATTATTCATTATTAA
TTCTATGCTTTAAATTTTAAAGCAAATATTTATTTTACAAAACCTAATTTAGAGCTTAAA
TTGCTATTAAGAGAGAGACATAAATTTTAATAAAATTCTGAATTATATCACATGAAAAAA
AAGAATCAAATTTTGATAGAAACTATTGATTTTTAAATATGTGAAATAGTTGTTTTTAGA
TAAATAAAATTGAAAATAAATACATTTTTAACTTATTAAATAAATTATTATAATAAAAGT
AACTTGATGAAGGCAAGATGACAACTTAAAATAATCCTTTAGAAATAAAATCTACTATTA
ATTATCCTTGTTTATTCAAAGATTTGAGAGATAAGGGTTTAAAGCCTATTATTGTTGTTC
CTACTATGGGTAGAACAGGAAATATTTCACTATTTAATGCCAAAAAATTCTTAGCAGAAG
GTAAATATGAAGATCCTGAAAATAAAGATTCTGATAACAGTGAAAGAGTCATTTAAATCG
AAAAGAATATAAAGGGACACAATTTCCTTTTCGAAGTCTACGATAATGTTGGTACATTTG
AATCCAAAAATAATCCTTCACAAAAAGTAATATTGATTTTTTATTTAAAACATCAATTAA
AGTTTTATTTATTTATTTTTATTTTAGTCTAAATGGGAGAGAGTTGTCGGTGTGTTCGTT
AGTGGTTAAAAATATCAATTCAAAGGATGGCCTAAAGAAGATAATATTCCCAGTATCTTA
GATTAAGTTAAAGGCTTCTATTTAAAATACTACGATATTCCTACTCCAGATTAAGTTGCA
AATTGGAATGTTAAAATTGTATCAGTATATCGTAATAAAAGACATTTAGATTTCCCAGCT
TATGAATAATTTTGGTAGGAGCTAGAAAATTTTATGATTCAACCAAGAAACAAATAAAAA
TGA