Identifiers and Description

Gene Model Identifier

TTHERM_00729170

Standard Name

CDC7 (CDC7 protein kinase)

Aliases

PreTt07318 | 118.m00146 | 3739.m00068

Description

Protein kinase domain containing protein. Sequence similarity to the CDC7 protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00729170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17976.19.997093137033517e-262protein kinase domain-containi
ng protein (588 aa)
OxytrichaContig18195.0.g149.995951036711152e-55Protein kinase domain
SGDYOR061W6.002144168983342e-19CKA2 Alpha catalytic subunit o
f casein kinase 2 (CK2), a Ser
/Thr protein kinase with roles
in cell growth and proliferat
ion; CK2, comprised of CKA1, C
KA2, CKB1 and CKB2, has many s
ubstrates including transcript
ion factors and all RNA polyme
rase
DictyBaseDDB_G02864814.0002685161515803e-16DDB_G0286481 on chromosome: 4
position 4514745 to 4516770
WormBaseWBGene000154780.0000000000006997872742366828Putative serine/threonine-prot
ein kinase C05D10.2 status:C
onfirmed UniProt:Q11179 pr
otein_id:CCD63173.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729170(coding)
ATGAAGCCAAATATTCCTATCCAAGGAGATTTCCATTAATTTGCACCAGGCATGATTCCT
GCTAACTGTTAATTCTAACAGATCGTACCAAATATCCCAGTTCCATAAGCTTAAGGCGCT
ATGTATAATATAGCAAATCCTCAATAGCAGATATATACAAAGAACATTTATTAGACATAG
CCAATTTAGAAACGTCAGGAGAAACCTAAAGAAAAGCAGAATTTCTAACAAGAGAAATAT
TATAAGGACAAGCCAGCAGATTTTAAATACCTGCATAGCCATGGATACTTGGTAAACAAA
GAATTAGGTAGAGGTGGCTATGGTGTTGTGTATAAGGCATATGAATATCGAGATGGAGTA
GTTAACAAAAAAAAGAAGTTTGCCATTAAAATTAATTTCCAAACTGTATCTCCGGAGCTT
ATATTTTCTGAAATAGCCTTTCTTACACTATTAAAAGGTTAACCTTGCACACCATAAATG
GTAGACTTGTTCACTTAAGAAGAAAAGACTCACATAGTCATTGAGTACTTTAAATATGAG
CCATTTATTAAATTCTTTGCAGAATCAAATATGGAAGAAATTAAACACTACATTTATCAA
ATGCTTTTAGCTGTTAAAACTTTAAAATCTATGGGTATTTATCACAGAGATGTTAAGCCT
GGTAATTTTCTGTATAACACTGCTGAGAAAAAGGGAATTTTGATCGATTACGGTTTATCT
GAAATAGATGATAAATTTATTGAAAATTTGAAAGAATAATAGAGACAGAAAAAGGATCCT
GAAATACAAAAAAAAATTGATCTTTACTAAAATATCAAAAAATGCGAAAAAATTGTAGGA
AAAAATAAAATAGGTACTGAGTCTTTTATGCCTTTGGAATCTATTCTTAGATACAGGGAT
TAAGGATATTAAGTTGACATTTGGCCAATAGGTGTTGTATTCCTTTAGTTCTTATTGAAA
AAGTATAACATATTCAACAATGTTAGAATGCAAAATAAACCTAATCAAAATAAAAATAAT
CACAATAAATCTGGTTAAATAAAAAACACTTATTTTATCACTTTCATATTAGAGTTAGCT
AATATTTTTGGATCAGATGCTGTTATTGAGCTTTGTAGAAAATATGAGTATGAAGTGAGC
TTGCCTAACGAGCTTCCCAAGGGACCAATTAACTTCAAAGAAATTATTAAAAAAGAAGAG
TTTGATGACGTAGCCAATGATTTGCTTACAAAGTTGATAGCACTTGACTAGGCAGATAGA
ATATCTGTTGAAGATGCCCTGAATCATCCATTTTTTGATAGTATAAGAGATTATGAAGCA
AAAAAATAGCAATAATAATTATAAAATCAATAAAATCTATAATAACAATAGTAATAATCT
ATTCATAAAAGTCAAATAATACAAATATCTCCTGATTAAATATCATAAGCTTAGTAACCT
ATTTAACAAATGCCTAAGAAATCCCTTTCTTCTTAAAATGCTATGATTTAATAAGTAACT
GTTGGAACTTAAATATAAAATAATCCATCAATCATGGGCTCTTATTAACCATTTTTATAT
AACACTAATCCCGGAATATAAATTTTAGGACCATTATACAATTAATCTCCATTTCCTATT
TAACAAGCAGGAGCTATTCCTTAAGTAGTGAACCCTTAAAGTTTTTAAGCATTTACTAAT
CCAAGCAAGAATGGTCTTAATATTTAACCACCTAAATGA


>TTHERM_00729170(protein)
MKPNIPIQGDFHQFAPGMIPANCQFQQIVPNIPVPQAQGAMYNIANPQQQIYTKNIYQTQ
PIQKRQEKPKEKQNFQQEKYYKDKPADFKYLHSHGYLVNKELGRGGYGVVYKAYEYRDGV
VNKKKKFAIKINFQTVSPELIFSEIAFLTLLKGQPCTPQMVDLFTQEEKTHIVIEYFKYE
PFIKFFAESNMEEIKHYIYQMLLAVKTLKSMGIYHRDVKPGNFLYNTAEKKGILIDYGLS
EIDDKFIENLKEQQRQKKDPEIQKKIDLYQNIKKCEKIVGKNKIGTESFMPLESILRYRD
QGYQVDIWPIGVVFLQFLLKKYNIFNNVRMQNKPNQNKNNHNKSGQIKNTYFITFILELA
NIFGSDAVIELCRKYEYEVSLPNELPKGPINFKEIIKKEEFDDVANDLLTKLIALDQADR
ISVEDALNHPFFDSIRDYEAKKQQQQLQNQQNLQQQQQQSIHKSQIIQISPDQISQAQQP
IQQMPKKSLSSQNAMIQQVTVGTQIQNNPSIMGSYQPFLYNTNPGIQILGPLYNQSPFPI
QQAGAIPQVVNPQSFQAFTNPSKNGLNIQPPK


>TTHERM_00729170(gene)
ATGAAGCCAAATATTCCTATCCAAGGAGATTTCCATTAATTTGCACCAGGCATGATTCCT
GCTAACTGTTAATTCTAACAGATCGTACCAAATATCCCAGTTCCATAAGCTTAAGGCGCT
ATGTATAATATAGCAAATCCTCAATAGCAGATATATACAAAGAACATTTATTAGACATAG
CCAATTTAGAAACGTCAGGAGTAATAATTTCAAAAATTTAAATAAATAGGTCATATTTTA
TACTTGTTTTAAAACTAGGAAACCTAAAGAAAAGCAGAATTTCTAACAAGAGAAATATTA
TAAGGACAAGCCAGCAGATTTTAAATACCTGCATAGCCATGGATACTTGGTAAACAAAGA
ATTAGGTAGAGGTGGCTATGGTGTTGTGTATAAGGCATATGAATAGTATGAATAATTTCT
TTTTTATATTTACCCTACTTAAAGAAGAATAGCCATTATTTCAAATTATTTAAAATTCTT
TAAGTTAAGAAGAAAAGCGGGCATTATTTTCAAAATAGATTAAAGTTAAATTAGATTGTA
AATGAACATGAAACTAAAAAATAAGAATTTAAAATGATAAATTTTAATCCAATAAATCAG
AATATAATTTTAATGTTTTCTAATGTTTCTTCTCAATAAATACCAAAAAATCATGATCTA
TAATCCTAATATTTATTAAATATTACTCTCATTTTAATTGGTTTCCATAGCTGCTTTTCT
TTTTTGTTAAAATCAGCTCATGATAAGAAATAATTAGAAAAAAAATAGAAATAAAATAGA
ATGAATTCGATTCTAATATATTATAGGCGCTTAATTTTATATGCTACAAAATTCAATACT
TTGATTTATGATAATTACTTTGCTTTGATTTTCTCTTTCTAAGCAAGCAAACAATATATT
AAAATTCTATTTATATTAAATAGTCGAGATGGAGTAGTTAACAAAAAAAAGAAGTTTGCC
ATTAAAATTAATTTCCAAACTGTATCTCCGGAGCTTATATTTTCTGAAATAGCCTTTCTT
ACACTATTAAAAGGTTAACCTTGCACACCATAAATGGTAGACTTGTTCACTTAAGAAGAA
AAGACTCACATAGTCATTGAGTACTTTAAATATGAGCCATTTATTGTAAATTTTCTTTAT
AATAATTGTTAAGCCAGCAAATATCTAACTTTTCTATTTCAAACTATTTTTAAAGAAATT
CTTTGCAGAATCAAATATGGAAGAAATTAAACACTACATTTATCAAATGCTTTTAGCTGT
TAAAACTTTAAAATCTATGGGTATTTATCACAGAGATGTTAAGCCTGGTAATTTTCTGTA
TAACACTGCTGAGAAAAAGGGAATTTTGATCGATTACGGTTTATCTGAAATAGTAAAATT
TATTTGATTGTTTAGAAAATAACTAATAGTTTATTTATTTATTTATTTAAACAATAGGAT
GATAAATTTATTGAAAATTTGAAAGAATAATAGAGACAGAAAAAGGATCCTGAAATACAA
AAAAAAATTGATCTTTACTAAAATATCAAAAAATGCGAAAAAATTGTAGGAAAAAATAAA
ATAGGTAAATATTTAAAAATAATTAGATAATATAATTAATATATTTATTTTATGTTAAAT
CAATAACTAGGTACTGAGTCTTTTATGCCTTTGGAATCTATTCTTAGATACAGGGATTAA
GGATATTAAGTTGACATTTGGCCAATAGGTGTTGTATTCCTTTAGTTCTTATTGAAAAAG
TATAACATATTCAACAATGTTAGAATGCAAAATAAACCTAATCAAAATAAAAATAATCAC
AATAAATCTGGTTAAATAAAAAACACTTATTTTATCACTTTCATATTAGAGTTAGCTAAT
ATTTTTGGATCAGATGCTGTTATTGAGCTTTGTAGAAAATATGGTAATTATCTTATTTTA
TTATAACTTTTTAACGTTTTTTTCTATTTAGAGTATGAAGTGAGCTTGCCTAACGAGCTT
CCCAAGGGACCAATTAACTTCAAAGAAATTATTAAAAAGTAATCATAAATTATTTAGATT
TTTCATAACTTAACCATAATTTTTTTGCAATTTTGTAGAGAAGAGTTTGATGACGTAGCC
AATGATTTGCTTACAAAGTTGATAGCACTTGACTAGGCAGATAGAATATCTGTTGAAGAT
GCCCTGAATCATCCATTTTTTGATAGTATAAGAGATTATGAAGCAAAAAAATAGCAATAA
TAATTATAAAATCAATAAAATCTATAATAACAATAGTAATAATCTATTCATAAAAGTCAA
ATAATACAAATATCTCCTGATTAAATATCATAAGCTTAGTAACCTATTTAACAAATGCCT
AAGAAATCCCTTTCTTCTTAAAATGCTATGATTTAATAAGTAACTGTTGGAACTTAAATA
TAAAATAATCCATCAATCATGGGCTCTTATTAACCATTTTTATATAACACTAATCCCGGA
ATATAAATTTTAGGACCATTATACAATTAATCTCCATTTCCTATTTAACAAGCAGGAGCT
ATTCCTTAAGTAGTGAACCCTTAAAGTTTTTAAGCATTTACTAATCCAAGCAAGAATGGT
CTTAATATTTAACCACCTAAATGA