Identifiers and Description

Gene Model Identifier

TTHERM_00729170

Standard Name

CDC7 (CDC7 protein kinase)

Aliases

PreTt07318 | 118.m00146 | 3739.m00068

Description

CDC7 kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the CDC7 protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00729170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17976.19.997093137033517e-262protein kinase domain-containi
ng protein (588 aa)
OxytrichaContig18195.0.g149.995951036711152e-55Protein kinase domain
SGDYOR061W6.002144168983342e-19CKA2 Alpha catalytic subunit o
f casein kinase 2 (CK2), a Ser
/Thr protein kinase with roles
in cell growth and proliferat
ion; CK2, comprised of CKA1, C
KA2, CKB1 and CKB2, has many s
ubstrates including transcript
ion factors and all RNA polyme
rase
DictyBaseDDB_G02864814.0002685161515803e-16DDB_G0286481 on chromosome: 4
position 4514745 to 4516770
WormBaseWBGene000154780.0000000000006997872742366828Putative serine/threonine-prot
ein kinase C05D10.2 status:C
onfirmed UniProt:Q11179 pr
otein_id:CCD63173.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729170(coding)
ATGAAGCCAAATATTCCTATCCAAGGAGATTTCCATTAATTTGCACCAGGCATGATTCCT
GCTAACTGTTAATTCTAACAGATCGTACCAAATATCCCAGTTCCATAAGCTTAAGGCGCT
ATGTATAATATAGCAAATCCTCAATAGCAGATATATACAAAGAACATTTATTAGACATAG
CCAATTTAGAAACGTCAGGAGAAACCTAAAGAAAAGCAGAATTTCTAACAAGAGAAATAT
TATAAGGACAAGCCAGCAGATTTTAAATACCTGCATAGCCATGGATACTTGGTAAACAAA
GAATTAGGTAGAGGTGGCTATGGTGTTGTGTATAAGGCATATGAATATCGAGATGGAGTA
GTTAACAAAAAAAAGAAGTTTGCCATTAAAATTAATTTCCAAACTGTATCTCCGGAGCTT
ATATTTTCTGAAATAGCCTTTCTTACACTATTAAAAGGTTAACCTTGCACACCATAAATG
GTAGACTTGTTCACTTAAGAAGAAAAGACTCACATAGTCATTGAGTACTTTAAATATGAG
CCATTTATTAAATTCTTTGCAGAATCAAATATGGAAGAAATTAAACACTACATTTATCAA
ATGCTTTTAGCTGTTAAAACTTTAAAATCTATGGGTATTTATCACAGAGATGTTAAGCCT
GGTAATTTTCTGTATAACACTGCTGAGAAAAAGGGAATTTTGATCGATTACGGTTTATCT
GAAATAGATGATAAATTTATTGAAAATTTGAAAGAATAATAGAGACAGAAAAAGGATCCT
GAAATACAAAAAAAAATTGATCTTTACTAAAATATCAAAAAATGCGAAAAAATTGTAGGA
AAAAATAAAATAGGTACTGAGTCTTTTATGCCTTTGGAATCTATTCTTAGATACAGGGAT
TAAGGATATTAAGTTGACATTTGGCCAATAGGTGTTGTATTCCTTTAGTTCTTATTGAAA
AAGTATAACATATTCAACAATGTTAGAATGCAAAATAAACCTAATCAAAATAAAAATAAT
CACAATAAATCTGGTTAAATAAAAAACACTTATTTTATCACTTTCATATTAGAGTTAGCT
AATATTTTTGGATCAGATGCTGTTATTGAGCTTTGTAGAAAATATGAGTATGAAGTGAGC
TTGCCTAACGAGCTTCCCAAGGGACCAATTAACTTCAAAGAAATTATTAAAAAAGAAGAG
TTTGATGACGTAGCCAATGATTTGCTTACAAAGTTGATAGCACTTGACTAGGCAGATAGA
ATATCTGTTGAAGATGCCCTGAATCATCCATTTTTTGATAGTATAAGAGATTATGAAGCA
AAAAAATAGCAATAATAATTATAAAATCAATAAAATCTATAATAACAATAGTAATAATCT
ATTCATAAAAGTCAAATAATACAAATATCTCCTGATTAAATATCATAAGCTTAGTAACCT
ATTTAACAAATGCCTAAGAAATCCCTTTCTTCTTAAAATGCTATGATTTAATAAGTAACT
GTTGGAACTTAAATATAAAATAATCCATCAATCATGGGCTCTTATTAACCATTTTTATAT
AACACTAATCCCGGAATATAAATTTTAGGACCATTATACAATTAATCTCCATTTCCTATT
TAACAAGCAGGAGCTATTCCTTAAGTAGTGAACCCTTAAAGTTTTTAAGCATTTACTAAT
CCAAGCAAGAATGGTCTTAATATTTAACCACCTAAATGA


>TTHERM_00729170(protein)
MKPNIPIQGDFHQFAPGMIPANCQFQQIVPNIPVPQAQGAMYNIANPQQQIYTKNIYQTQ
PIQKRQEKPKEKQNFQQEKYYKDKPADFKYLHSHGYLVNKELGRGGYGVVYKAYEYRDGV
VNKKKKFAIKINFQTVSPELIFSEIAFLTLLKGQPCTPQMVDLFTQEEKTHIVIEYFKYE
PFIKFFAESNMEEIKHYIYQMLLAVKTLKSMGIYHRDVKPGNFLYNTAEKKGILIDYGLS
EIDDKFIENLKEQQRQKKDPEIQKKIDLYQNIKKCEKIVGKNKIGTESFMPLESILRYRD
QGYQVDIWPIGVVFLQFLLKKYNIFNNVRMQNKPNQNKNNHNKSGQIKNTYFITFILELA
NIFGSDAVIELCRKYEYEVSLPNELPKGPINFKEIIKKEEFDDVANDLLTKLIALDQADR
ISVEDALNHPFFDSIRDYEAKKQQQQLQNQQNLQQQQQQSIHKSQIIQISPDQISQAQQP
IQQMPKKSLSSQNAMIQQVTVGTQIQNNPSIMGSYQPFLYNTNPGIQILGPLYNQSPFPI
QQAGAIPQVVNPQSFQAFTNPSKNGLNIQPPK


>TTHERM_00729170(gene)
ATGAAGCCAAATATTCCTATCCAAGGAGATTTCCATTAATTTGCACCAGGCATGATTCCT
GCTAACTGTTAATTCTAACAGATCGTACCAAATATCCCAGTTCCATAAGCTTAAGGCGCT
ATGTATAATATAGCAAATCCTCAATAGCAGATATATACAAAGAACATTTATTAGACATAG
CCAATTTAGAAACGTCAGGAGTAATAATTTCAAAAATTTAAATAAATAGGTCATATTTTA
TACTTGTTTTAAAACTAGGAAACCTAAAGAAAAGCAGAATTTCTAACAAGAGAAATATTA
TAAGGACAAGCCAGCAGATTTTAAATACCTGCATAGCCATGGATACTTGGTAAACAAAGA
ATTAGGTAGAGGTGGCTATGGTGTTGTGTATAAGGCATATGAATAGTATGAATAATTTCT
TTTTTATATTTACCCTACTTAAAGAAGAATAGCCATTATTTCAAATTATTTAAAATTCTT
TAAGTTAAGAAGAAAAGCGGGCATTATTTTCAAAATAGATTAAAGTTAAATTAGATTGTA
AATGAACATGAAACTAAAAAATAAGAATTTAAAATGATAAATTTTAATCCAATAAATCAG
AATATAATTTTAATGTTTTCTAATGTTTCTTCTCAATAAATACCAAAAAATCATGATCTA
TAATCCTAATATTTATTAAATATTACTCTCATTTTAATTGGTTTCCATAGCTGCTTTTCT
TTTTTGTTAAAATCAGCTCATGATAAGAAATAATTAGAAAAAAAATAGAAATAAAATAGA
ATGAATTCGATTCTAATATATTATAGGCGCTTAATTTTATATGCTACAAAATTCAATACT
TTGATTTATGATAATTACTTTGCTTTGATTTTCTCTTTCTAAGCAAGCAAACAATATATT
AAAATTCTATTTATATTAAATAGTCGAGATGGAGTAGTTAACAAAAAAAAGAAGTTTGCC
ATTAAAATTAATTTCCAAACTGTATCTCCGGAGCTTATATTTTCTGAAATAGCCTTTCTT
ACACTATTAAAAGGTTAACCTTGCACACCATAAATGGTAGACTTGTTCACTTAAGAAGAA
AAGACTCACATAGTCATTGAGTACTTTAAATATGAGCCATTTATTGTAAATTTTCTTTAT
AATAATTGTTAAGCCAGCAAATATCTAACTTTTCTATTTCAAACTATTTTTAAAGAAATT
CTTTGCAGAATCAAATATGGAAGAAATTAAACACTACATTTATCAAATGCTTTTAGCTGT
TAAAACTTTAAAATCTATGGGTATTTATCACAGAGATGTTAAGCCTGGTAATTTTCTGTA
TAACACTGCTGAGAAAAAGGGAATTTTGATCGATTACGGTTTATCTGAAATAGTAAAATT
TATTTGATTGTTTAGAAAATAACTAATAGTTTATTTATTTATTTATTTAAACAATAGGAT
GATAAATTTATTGAAAATTTGAAAGAATAATAGAGACAGAAAAAGGATCCTGAAATACAA
AAAAAAATTGATCTTTACTAAAATATCAAAAAATGCGAAAAAATTGTAGGAAAAAATAAA
ATAGGTAAATATTTAAAAATAATTAGATAATATAATTAATATATTTATTTTATGTTAAAT
CAATAACTAGGTACTGAGTCTTTTATGCCTTTGGAATCTATTCTTAGATACAGGGATTAA
GGATATTAAGTTGACATTTGGCCAATAGGTGTTGTATTCCTTTAGTTCTTATTGAAAAAG
TATAACATATTCAACAATGTTAGAATGCAAAATAAACCTAATCAAAATAAAAATAATCAC
AATAAATCTGGTTAAATAAAAAACACTTATTTTATCACTTTCATATTAGAGTTAGCTAAT
ATTTTTGGATCAGATGCTGTTATTGAGCTTTGTAGAAAATATGGTAATTATCTTATTTTA
TTATAACTTTTTAACGTTTTTTTCTATTTAGAGTATGAAGTGAGCTTGCCTAACGAGCTT
CCCAAGGGACCAATTAACTTCAAAGAAATTATTAAAAAGTAATCATAAATTATTTAGATT
TTTCATAACTTAACCATAATTTTTTTGCAATTTTGTAGAGAAGAGTTTGATGACGTAGCC
AATGATTTGCTTACAAAGTTGATAGCACTTGACTAGGCAGATAGAATATCTGTTGAAGAT
GCCCTGAATCATCCATTTTTTGATAGTATAAGAGATTATGAAGCAAAAAAATAGCAATAA
TAATTATAAAATCAATAAAATCTATAATAACAATAGTAATAATCTATTCATAAAAGTCAA
ATAATACAAATATCTCCTGATTAAATATCATAAGCTTAGTAACCTATTTAACAAATGCCT
AAGAAATCCCTTTCTTCTTAAAATGCTATGATTTAATAAGTAACTGTTGGAACTTAAATA
TAAAATAATCCATCAATCATGGGCTCTTATTAACCATTTTTATATAACACTAATCCCGGA
ATATAAATTTTAGGACCATTATACAATTAATCTCCATTTCCTATTTAACAAGCAGGAGCT
ATTCCTTAAGTAGTGAACCCTTAAAGTTTTTAAGCATTTACTAATCCAAGCAAGAATGGT
CTTAATATTTAACCACCTAAATGA