Identifiers and Description

Gene Model Identifier

TTHERM_00600480

Standard Name

CDC55 (protein phosphatase CDC55)

Aliases

PreTt22111 | 83.m00180 | 3685.m00072

Description

protein phosphatase regulatory subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00600480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14911.19.997093137033517e-262protein phosphatase regulatory
subunit (426 aa)
SGDYGL190C6.99920276797163e-121CDC55 Non-essential regulatory
subunit B of protein phosphat
ase 2A (PP2A); involved in reg
ulation of mitotic exit; requi
red for correct nuclear divisi
on and chromosome segregation
in meiosis; maintains sequestr
ation of the phosphatase Cdc14
p in nucleolus during early me
iosis, which is essential for
meiosis I spindle assembly; li
mits formation of PP2A-Rts1p h
olocomplexes to ensure timely
dissolution of sister chromoso
me cohesion; found in nucleus,
bud neck and bud of most cell
s
DictyBaseDDB_G02839053.998604088504543e-111phr2aB on chromosome: 4 positi
on 1423354 to 1425584
WormBaseWBGene000063522.9992439173235726e-110locus:sur-6 status:Confirmed
UniProt:G5EDR3 protein_id
:CAB03008.1
OxytrichaContig16838.0.g292.998957050488393e-103WD domain, G-beta repeat
Stentor CoeruleusSteCoe_18030.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600480(coding)
ATGAAAGGTAGTGCTCCTAAATTAGATTGGAAATTTTTGTAAGTATTTGGTGATAAGGCT
TCTGTTGAGAAGGTGTCAGAAGAAGATATCATTTCAGCTATTTCATTCGATAAAACTGGA
CGCTTTTTATCATTGGGTGATAGAGCTGGTAGATTAATTATTTTTGAATAATGCGCTACC
TCCAAATCTAAGAGGGTTGAGTTCCAGTATCTTACTGAATTATAGAGCCATACTAGAGAA
TTCGATTACTTAAAGTCAACTGATATCGAAGAGAAGATTAATTAGATCGTATGGATGAGA
AATTCAGGTAAGAATATGTATGTTTTGACTACAAATGACAAAACTGTCAAACTTTGGAAG
ATTTCTGAAAAGAATATCAAAAAAGTTATGAAGGGAGCAGGAAAAGATTTAAATATGCCA
AAATTGCAAACTCTAGAAAGTGGCTTAATGCCAACAATTCGTAAGGTCTACCCCAACCTT
CATACTTATCACATTAATGCCATTTCTGCTTCTTAAAATGAAGAATTTTTGCTCTCATCT
GATGATTTAAGAGTTAATCTATGGAGTATTGAAAATCCAAATAAGGCATTTGTTGCTGTT
GATCTTAAACCAGATAATCTCGAAGAACTTTCTGAAGTTATTACATCATCATAGTTCCAT
CCTCAACATGACAATATGTTCTTGTACACTACTTCTAAGGGTGTAACTAAAGTAGGTGAT
ATGAGAAAGAGTGGTATATGTGATAACACTGCTATGACATTCTCTGAAAAGGAAGATCCT
TCAAAAAAGAACTTCTTCACTGAAATTGTAGCCTCTATTTCTGATGCTACATTTGCTCGT
AACGGAAAATATATTTTTGCAAGAGATTTCTTGAGCGTAAAAGTTTGGGATGTTGCTATG
CAAAATAAGCCCGTTGTAACAATTCCTATTTTTGAACCTCTTAAGAGTAAGCTTTGTGAG
TTATATGAAAATGAATGTATATTTGATAAATTCTCAATCTCAAGCAGTCCAGACAGCAAC
TTCTTTGTCACTGGTAATTTCAACAGCACTTTCCACGTGATTGATAGAAATGGCGACTTA
AATAACTAATTCGAACTTAACTTTAATAAAAAGACTCTTATTAAACCTATTCCTCCTAAA
TATTTTGAAAACTTAGGCTCTAATTATGATTTTTCAAGAAAAGTTTTAAAAACTGCTTAC
AGCCCTGTTAATCATACTCTAGCTATTTCTTGTCTTAACTGTTTGTATTTTTACAATGCA
ACTGCTCCCTCTGCTTGA


>TTHERM_00600480(protein)
MKGSAPKLDWKFLQVFGDKASVEKVSEEDIISAISFDKTGRFLSLGDRAGRLIIFEQCAT
SKSKRVEFQYLTELQSHTREFDYLKSTDIEEKINQIVWMRNSGKNMYVLTTNDKTVKLWK
ISEKNIKKVMKGAGKDLNMPKLQTLESGLMPTIRKVYPNLHTYHINAISASQNEEFLLSS
DDLRVNLWSIENPNKAFVAVDLKPDNLEELSEVITSSQFHPQHDNMFLYTTSKGVTKVGD
MRKSGICDNTAMTFSEKEDPSKKNFFTEIVASISDATFARNGKYIFARDFLSVKVWDVAM
QNKPVVTIPIFEPLKSKLCELYENECIFDKFSISSSPDSNFFVTGNFNSTFHVIDRNGDL
NNQFELNFNKKTLIKPIPPKYFENLGSNYDFSRKVLKTAYSPVNHTLAISCLNCLYFYNA
TAPSA


>TTHERM_00600480(gene)
ATGAAAGGTAGTGCTCCTAAATTAGATTGGAAATTTTTGTAAGTATTTGGTGATAAGGCT
TCTGTTGAGAAGGTGTCAGAAGAAGATATCATTTCAGCTATTTCATTCGATAAAACTGGA
CGCTTTTTATCATTGGGTGATAGAGCTGGTAGATTAATTATTTTTGAATAATGCGCTACC
TCCAAATCTAAGAGGGTTGAGTTCCAGTATCTTACTGAATTATAGAGCCATACTAGAGAA
TTCGATTACTTAAAGTCAACTGATATCGAAGAGAAGATTAATTAGATCGTATGGATGAGA
AATTCAGGTAAGAATATGTATGTTTTGACTACAAATGACAAAACTGTCAAACTTTGGAAG
ATTTCTGAAAAGAATATCAAAAAAGTTATGAAGGGAGCAGGAAAAGATTTAAATATGCCA
AAATTGCAAACTCTAGAAAGTGGCTTAATGCCAACAATTCGTAAGGTCTACCCCAACCTT
CATACTTATCACATTAATGCCATTTCTGCTTCTTAAAATGAAGAATTTTTGCTCTCATCT
GATGATTTAAGAGTTAATCTATGGAGTATTGAAAATCCAAATAAGGTAATTTGCAAAAAC
GTTTTATTAGTTTAACCTTAACGCCAATCAAGCCAATCTCATCCCTTTTAAATTTTACAA
GCAAATTAAGTTAAAATAAATCCATTTAAAGAGTTTCATTTTTAAAAAGCCATGTATTGA
TCTAGGCAAAATTTATTATAATTATTAATATTTTTGCTGTTTCTTTTACATGGGATTGAA
TTAAATAAAATATATGCTATCAATTAGTCTTAATTATATTTAAAAATAATCAAATTTATT
TATAGCAACCTTAGAGAGTTCGTTTTTTGTTTTGCCTAGTCAATATCAAACGAAATGCAA
TAAATAAAATTTATTAGCATATGCTAACAAAATTAAAAAAATATTTTACTGAATGCAAAT
TAAATTAATTTTGATAAATTATAATTCATTAAACTTATTCATTAATCTTAATGTGCTTTT
ATGATTAAAATAAGCATCGCTTTAAGCTAAAAATTAATTTTAATCAGTAAAATAAATCAT
CATTTATTTAATAATTTTAAATAGGCATTTGTTGCTGTTGATCTTAAACCAGATAATCTC
GAAGAACTTTCTGAAGTTATTACATCATCATAGTTCCATCCTCAACATGACAATATGTTC
TTGTACACTACTTCTAAGGGTGTAACTAAAGTAGGTGATATGAGAAAGAGTGGTATATGT
GATAACACTGCTATGACATTCTCTGAAAAGGAAGATCCTTCAAAAAAGAACTTCTTCACT
GAAATTGTAGCCTCTATTTCTGATGCTACATTTGCTCGTAACGGAAAATATATTTTTGCA
AGAGATTTCTTGAGCGTAAAAGTTTGGGATGTTGCTATGCAAAATAAGCCCGTTGTAACA
ATTCCTATTTTTGAACCTCTTAAGAGTAAGCTTTGTGAGTTATATGAAAATGAATGTATA
TTTGATAAATTCTCAATCTCAAGCAGTCCAGACAGCAACTTCTTTGTCACTGGTAATTTC
AACAGCACTTTCCACGTGATTGATAGAAATGGCGACTTAAATAACTAATTCGAACTTAAC
TTTAATAAAAAGACTCTTATTAAACCTATTCCTCCTAAATATTTTGAAAACTTAGGCTCT
AATTATGATTTTTCAAGAAAAGTTTTAAAAACTGCTTACAGCCCTGTTAATCATACTCTA
GCTATTTCTTGTCTTAACTGTTTGTATTTTTACAATGCAACTGCTCCCTCTGCTTGA