Identifiers and Description

Gene Model Identifier

TTHERM_00584810

Standard Name

CDC45

Aliases

PreTt04089 | 80.m00135 | 3675.m00033

Description

DNA replication pre-initiation complex subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00584810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15231.19.997093137033517e-262hypothetical protein (683 aa)
OxytrichaContig12528.0.g867.002333582705508e-91CDC45-like protein
DictyBaseDDB_G02677484.9995619603214884e-57cdc45 on chromosome: 1 positio
n 776324 to 778499
SGDYLR103C7.000698492250867e-53CDC45 DNA replication initiati
on factor; recruited to MCM pr
e-RC complexes at replication
origins; promotes release of M
CM from Mcm10p, recruits elong
ation machinery; mutants in hu
man homolog may cause velocard
iofacial and DiGeorge syndrome
s
Stentor CoeruleusSteCoe_369891.9792598779469045e-32
WormBaseWBGene000093720.000000000000006999063783600386locus:evl-18 status:Confirme
d UniProt:Q7JMR0 protein_i
d:CAA84320.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00584810(coding)
ATGCTGATTGATTAAACATCTATTATTCATTGCTACGAAAAAATATAAAAAAAGGCAATT
AATGGTTGTGTCACTGTGTTTATATTTGTAGCATTCGATGCTGATTCGCTATGCTCTTTA
AAAATATTAACAGGATTACTTAAGAGTGATAATATAGCATACAAAGTTTTACCTGTAACT
GGGTTTAGTTAACTAGAAGCTTCTATTGATGAGTGTTAAACTAGTGAAAGCATATAAAGC
ATGATATTTATAAATTGTGGAGGTGTTTTGGATCTTACATAAAAATGGTTTGTTACAGAG
AAAACCAAAATTAAAGCATACATTTTTGATAATCATAGACCTATTCATCATCATAATATA
GCAGACAAGAATAATATTGTTATAATTGATGATGGGACATAAAACCAATAAAATTGTCCA
GAAAGAGAAGATGAAATATTACAAATGACAGCTTAGCACGAAGAAGATGAAGATATTTCA
GATAATGATAATGAAGATTAAGATTATAGTGAAGAAGATGATGATGATTTATAAGAATAC
GAGGATGAAGATGAAGGGTTTGATGAAAATGGCGAGAATAAATTAAAGAACAAATTAGAT
AAAAAAAGAAAAGATTTAGCGTATGAGGATGAAGAAGAGGAAGAATTTGGAAAAAAAGAT
AGAAGAGAGAAAAATAGAAGAAAGAGAAGAAGTGATAAAAAGCTAAAAGAAAAGAAAATG
GAAAAAAAACTTAAAATAGAATAGCATAAATAAAAAATGGAGAATTACTATGAAGGTTTT
TATTATGGAAAAGCAACTAGTATGCTCATGTATAAAATATGCTAATAGGCTAATAAAGAA
AACAACAATTATTTATGGTACACAATCTTGGGTGCAACTGATCTTTTAATTCATGGAAAA
ATAACATAATAACAATATGATCAAATGTATGAAGAGCTTGTAATTGAAGTAGAGAAAGTT
AATATTTAAAAATAAGAATTTAGCTAAGATTTGAACGAGTCCATCGCCAATGAATAAAGA
TAGAAAAATATTGGCTTTATAGAAGCATCAAATGAATATAGATTTATTTGTTTAAGAAAT
TGGAATTTATATGAGAGTATATATTATTCTAATTACTTTGCAACTAAACTTGAAATTTGG
AATGAAAATGGAGATTAAAAAATAACTAGATTAATAGCATTGCTCGGAATACCTTTAGAA
GAAGCTAAGTAGTAATATAAATTTATGAAAGCTTAATTCAAGGAAAAGTTAAAGGATAAT
ATTCACAGCGTTGCAACTAAATATAAATTGTATAATGTGCTATTTAACTCCTTTGTTAGA
TAGATAGATGAAAAGACTTAAGTCTCTTCAACGGATATGGTTTACTGTTTAACTGCTATT
TTAGAATGTCCTAAATAAATTTTGCAAAATATATTCGAAGACCCTTTAAAAGTTGGTTAA
AGCATTTAAACAGATAAGACTTCAGATAACAGCGAGGAAGGATCTAAAAATTATAATGAA
AAAGATATCTTTGATAGAATTAAGAATTTTTGGTGGGCATATGAGACTATATCTTCAAAA
GAAGCTGTATTAATATTAAAGGGAATTGATATCGCAATTCAATTTTAAAAAGCTATGGTA
AATGAAGCAAAATTTGTGATAGATAGAGATTTAATAACTCAGTGCAGTGATTTTAGATTT
TTAAAGCTAAATAACGATACATACTCTTAAAATTAATACTTTTAGCATCCTTATTCTTTA
TAAAAGCTTGCTCTATTTTTGATGGGTATATTTAAGGAGAAACAAAAAAGCAACCAACCA
ATAAAGCCTATTGTTTTAAGTATAAAAAATTCTATTACATAGACTCAGACCATTATAGGT
GTTGTTGGAAACCATTACTCTGCTAGCACTAAAAATGATTTTGCCTTTAAATTCTAGTCT
GCTGCAAAAGCCTTAAATCTTCAATATAAATAGGACGATTTTGAAACATCAATTATTGAA
ATCAAAGATTAAGATTTTGACGTTTTTCTTGATGAAATTACATTAGCCAAATGA


>TTHERM_00584810(protein)
MLIDQTSIIHCYEKIQKKAINGCVTVFIFVAFDADSLCSLKILTGLLKSDNIAYKVLPVT
GFSQLEASIDECQTSESIQSMIFINCGGVLDLTQKWFVTEKTKIKAYIFDNHRPIHHHNI
ADKNNIVIIDDGTQNQQNCPEREDEILQMTAQHEEDEDISDNDNEDQDYSEEDDDDLQEY
EDEDEGFDENGENKLKNKLDKKRKDLAYEDEEEEEFGKKDRREKNRRKRRSDKKLKEKKM
EKKLKIEQHKQKMENYYEGFYYGKATSMLMYKICQQANKENNNYLWYTILGATDLLIHGK
ITQQQYDQMYEELVIEVEKVNIQKQEFSQDLNESIANEQRQKNIGFIEASNEYRFICLRN
WNLYESIYYSNYFATKLEIWNENGDQKITRLIALLGIPLEEAKQQYKFMKAQFKEKLKDN
IHSVATKYKLYNVLFNSFVRQIDEKTQVSSTDMVYCLTAILECPKQILQNIFEDPLKVGQ
SIQTDKTSDNSEEGSKNYNEKDIFDRIKNFWWAYETISSKEAVLILKGIDIAIQFQKAMV
NEAKFVIDRDLITQCSDFRFLKLNNDTYSQNQYFQHPYSLQKLALFLMGIFKEKQKSNQP
IKPIVLSIKNSITQTQTIIGVVGNHYSASTKNDFAFKFQSAAKALNLQYKQDDFETSIIE
IKDQDFDVFLDEITLAK


>TTHERM_00584810(gene)
ATGCTGATTGATTAAACATCTATTATTCATTGCTACGAAAAAATATAAAAAAAGGCAATT
AATGGTTGTGTCACTGTGTTTATATTTGTAGCATTCGATGCTGATTCGCTATGCTCTTTA
AAAATATTAACAGTAAAAATTAAATTAGGATTAAAAATTAGTAGGAATTAGCAACAATTA
TTAAAATATTAAGGGATTACTTAAGAGTGATAATATAGCATACAAAGTTTTACCTGTAAC
TGGGTTTAGTTAACTAGAAGCTTCTATTGATGAGTGTTAAACTAGTGAAAGCGTAAATAA
TTCAGCATAAAATGGGTTTTTACAAATAGCTGCTTCTTTTATTATTAATAGATATAAAGC
ATGATATTTATAAATTGTGGAGGTGTTTTGGATCTTACATAAAAATGGTTTGTTACAGAG
AAAACCAAAATTAAAGCATACATTTTTGATAATCATAGACCTATTCATCATCATAATATA
GCAGACAAGAATAATGTAATTGCATGGATTTCTTTTTTCTTAATCATTTATGTGTTCTAT
TACTTGAGAATTGCTTATAATAAACACTCTAAAATTTAATCTTTTGAAATATTTCAGATT
GTTATAATTGATGATGGGACATAAAACCAATAAAATTGTCCAGAAAGAGAAGATGAAATA
TTACAAATGACAGCTTAGCACGAAGAAGATGAAGATATTTCAGATAATGATAATGAAGAT
TAAGATTATAGTGAAGAAGATGATGATGATTTATAAGAATACGAGGATGAAGATGAAGGG
TTTGATGAAAATGGCGAGAATAAATTAAAGAACAAATTAGATAAAAAAAGAAAAGATTTA
GCGTATGAGGATGAAGAAGAGGAAGAATTTGGAAAAAAAGATAGAAGAGAGAAAAATAGA
AGAAAGAGAAGAAGTGATAAAAAGCTAAAAGAAAAGAAAATGGAAAAAAAACTTAAAATA
GAATAGCATAAATGTAAAAATTTTAAATTATATCAAATTTTTAGCAAATTTCTTAGCAAA
TAAATACAAAACTGTTAAATATTTAGAAAAAATGGAGAATTACTATGAAGGTTTTTATTA
TGGAAAAGCAACTAGTATGCTCATGTATAAAATATGCTAATAGGCTAATAAAGAAAACAA
CAATTATTTATGGTACACAATCTTGGGTGCAACTGATCTTTTAATTCATGGAAAAATAAC
ATAATAACAATATGATCAAATGTATGAAGAGCTTGTAATTGAAGTAGAGAAAGTTAATAT
TTAAAAATAAGGTAATATTTTATTTTTCTTTATAAAAATAAAAATTGATTATTAATTTTG
AAAAATTATTTTTCCTTAATCAAATATAAAAATCTATAAAAAGAATTTAGCTAAGATTTG
AACGAGTCCATCGCCAATGAATAAAGATAGAAAAATATTGGCTTTATAGAAGCATCAAAT
GAGTAATATTTAGTTAGCCAAGTAATAGATTTGTAGATTTTTTTTATTATTTATAGATAT
AGATTTATTTGTTTAAGAAATTGGAATTTATATGAGAGTATATATTATTCTAATTACTTT
GCAACTAAACTTGAAATTTGGAATGAAAATGGAGATTAAAAAATAACTAGATTAATAGCA
TTGCTCGGAATACCTTTAGAAGAAGCTAAGTAGTAATATAAATTTATGAAAGTAAATCTT
AAAATAAATATTATGAGCAAATATTGATTGAGAAAATTAAAAATATATTTATATAAAAGG
CTTAATTCAAGGAAAAGTTAAAGGATAATATTCACAGCGTTGCAACTAAATATAAATTGT
ATAATGTGCTATTTAACTCCTTTGTTAGATAGATAGATGAAAAGACTTAAGTCTCTTCAA
CGGATATGGTTTACTGTTTAACTGCTATTTTAGAATGTCCTAAATAAATTTTGCAAAATA
TATTCGAAGACCCTTTAAAAGTTGGTGTAATTTTTTACTTATAATTAATAAAATTAAATT
ATAAGGGTTCAATTAATTATCGTTTTTAAAAAAACAAATTTTTCCTTAAAGTAAAGCATT
TAAACAGATAAGACTTCAGATAACAGCGAGGAAGGATCTAAAAATTATAATGAAAAAGAT
ATCTTTGATAGAATTAAGAATTTTTGGTGGGCATATGAGACTATATCTTCAAAAGAAGCT
GTATTAATATTAAAGGGAATTGATATCGCAATTCAATTTTAAAAAGCTATGGTAAATGAA
GGTAAATTATATTAGAAAAAAAGCTTAGTTCTAGACAAAATATTACTCTTTAGCAAATAA
TAACTATTACTATTTTAAAATAGCAAAATTTGTGATAGATAGAGATTTAATAACTCAGTG
CAGTGATTTTAGATTTTTAAAGCTAAATAACGATACATACTCTTAAAATTAATACTTTTA
GCATCCTTATTCTTTATAAAAGCTTGCTCTATTTTTGATGGGTATATTTAAGGAGAAACA
AAAAAGCAACCAACCAATAAAGCCTATTGTTTTAAGTATAAAAAATTCTATTACATAGAC
TCAGACCATTATAGGTGTTGTTGGAAACCATTACTCTGCTAGCACTAAAAAGTATGTTAA
AATTTAAAAACTACAAAAATATTTATTTTTATTAAATTCTAATTAAACTAAATATTTTTT
ATATTTAAAATTAGTGATTTTGCCTTTAAATTCTAGTCTGCTGCAAAAGCCTTAAATCTT
CAATATAAATAGGACGATTTTGAAACATCAATTATTGAAATCAAAGATTAAGATTTTGAC
GTTTTTCTTGATGAAATTACATTAGCCAAATGA