Identifiers and Description

Gene Model Identifier

TTHERM_00267910

Standard Name

CDC42 (Small rho-like GTPase CDC42)

Aliases

PreTt09826 | 24.m00257 | 3690.m00071

Description

small GTP-binding protein domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00267910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06884.15.001046458421685e-131small GTP-binding protein doma
in-containing protein (197 aa)
DictyBaseDDB_G02686225.997225115851065e-74rac1B on chromosome: 1 positio
n 2364212 to 2365034
SGDYLR229C8.002162267243937e-73CDC42 Small rho-like GTPase, e
ssential for establishment and
maintenance of cell polarity;
mutants have defects in the o
rganization of actin and septi
ns
WormBaseWBGene000003909.004385969422137e-73locus:cdc-42 Cell division c
ontrol protein 42 homolog st
atus:Confirmed UniProt:Q0506
2 protein_id:CCD70511.1
OxytrichaContig22449.0.g389.997652352281279e-57Ras family
Stentor CoeruleusSteCoe_55920.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000078

Sequences

>TTHERM_00267910(coding)
ATGGCTGAAAACAAAGAACCAATTAAGATAAAGTGCGTTATTGTTGGTGATGGTAGTGTT
GGTAAAACTTGCATTCTCCTTAGCTATACAAATGATTAATTCCCTACTGATTATGTCCCT
ACGATTTTCGATAATTACAGTGCTACTGTTAAGGTTGGTGATGAAATGATTAACCTTGGT
CTATGGGATACTGCAGGTCAAGAAGATTATAATAGATTGAGACCATTGAGTTATCCTTAA
TCAGATGTTTTCCTAATTACTTTCTCAGTCGTAGAGCCTGCTTCCTTTGAAAATGCTCTT
AAAAAGTGGTATCCTGAATTAGAAGAAAATGTGAAGAATGTCCCTAAAATATTTGTTGGA
AACAAAATTGATTTAAGAGATGAAAATATGGTTAAAAGTACTGGTAAAGATGCACCAATC
AGCTATTAAGCAGCTCAAAAGATCATTTCAGAATTAAATTGCAAATATGTTGAGTGTTCT
GCTTTAACTTAAAAAGGTCTTAAGAATGTTTTTGATTAAGCTATTAGAATTGCTTTGGCA
AACAAGAAAAAAACACCAAGAAAACCCTAAAATAGATGTGTCTTAATATGA


>TTHERM_00267910(protein)
MAENKEPIKIKCVIVGDGSVGKTCILLSYTNDQFPTDYVPTIFDNYSATVKVGDEMINLG
LWDTAGQEDYNRLRPLSYPQSDVFLITFSVVEPASFENALKKWYPELEENVKNVPKIFVG
NKIDLRDENMVKSTGKDAPISYQAAQKIISELNCKYVECSALTQKGLKNVFDQAIRIALA
NKKKTPRKPQNRCVLI


>TTHERM_00267910(gene)
ATGGCTGAAAACAAAGAACCAATTAAGATAAAGTGCGTTATTGTTGGTGATGGTAGTGTT
GGTAAAACTTGCATTCTCCTTAGGTAAAGCTTATCATTAATTATCTTATTCTAAGATTTG
TATAATGTAAATTGAAATATTAAAAAAATTAATAATAATAGCTATACAAATGATTAATTC
CCTACTGATTATGTCCCTACGATTTTCGATAATTACAGTGCTACTGTTAAGGTTGGTGAT
GAAATGATTAACCTTGGTCTATGGTATAAAATTAAAAATAAAGAAGTTCATAAAAGTATA
ATGTTGATTAATTACATATTTTCATAAATAAAGGGATACTGCAGGTCAAGAAGATTATAA
TAGATTGAGACCATTGAGTTATCCTTAATCAGATGTTTTCCTAATTACTTTCTCAGTCGT
AGAGCCTGCTTCCTTTGAAAATGCTCTTAAAAAGGTAAATTATCTGATCATTCTTAATAA
CTTGTATATTATGCAAGATGTTTACATAATTAAGTATTAATTTATTAATGGCGGAAATTA
TTTAATAATTTTAGATAAATGCATAATTAATTTTTAGTTTAACATATTTTGCACTAGCTC
ATAAGCTAAATTATGTATTCATAGTTAACTAATTACAAATTTATATTAAATAGTGGTATC
CTGAATTAGAAGAAAATGTGAAGAATGTCCCTAAAATATTTGTTGGAAACAAAATTGATT
TAAGAGATGAAAATATGGTTAAAAGTACTGGTAAAGATGCACCAATCAGCTATTAAGCAG
TAAAAATAATATTAATTCAAAGAATCTAAAAATTGTAGATTTTATATTTAATTAATGACA
AGATTATATTAATAATTTTAAATAATTTTACTTATATTTAATAATAGGCTCAAAAGATCA
TTTCAGAATTAAATTGCAAATATGTTGAGTGTTCTGCTTTAACTTAAAAAGGTCTTAAGA
ATGTTTTTGATTAAGCTATTAGAATTGCTTTGGCAAACAAGAAAAAAACACCAAGAAAAC
CCTAAAATAGATGTGTCTTAATATGA