Identifiers and Description

Gene Model Identifier

TTHERM_00583420

Standard Name

CDC33 (Cell Division Cycle 33)

Aliases

PreTt25679 | 79.m00193 | 3827.m00909

Description

Putative mRNA cap binding protein and translation initiation factor eIF4E

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00583420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07430.14.997910161537908e-106eukaryotic initiation factor 4
E family protein (172 aa)
OxytrichaContig22586.0.g1006.001249495680822e-29Eukaryotic initiation factor 4
E
DictyBaseDDB_G02819795.00179831534194e-27DDB_G0281979 on chromosome: 3
position 5208875 to 5210138
WormBaseWBGene000020625.9971655715910366e-21locus:ife-4 Eukaryotic trans
lation initiation factor 4E-4
status:Confirmed UniProt:Q
22888 protein_id:CCD63145.1
SGDYOL139C3.9992896861436003e-19CDC33 Cytoplasmic mRNA cap bin
ding protein and translation i
nitiation factor eIF4E; the eI
F4E-cap complex is responsible
for mediating cap-dependent m
RNA translation via interactio
ns with translation initiation
factor eIF4G (Tif4631p or Tif
4632p)
Stentor CoeruleusSteCoe_30516.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00583420(coding)
ATGTCTATGAAGCTTTCAAGAGGATACACCTTTTGGTTTGTTTCCGAAAGAGTTGAAAAT
AAAGATAATTATGTTAGTTAGCTTAAAAAAATTGGATCATTTAGTGATGTTGATGATTTT
TGGAAATATTATTAGCATATGGCAAGACCTGATAAATTACCAGAAGGTACTACTTTTTAT
TGTTTTACCGAAGGAGTTATGCCAATGTGGGAAGACGCTGCAAATGTTGGTGGAGGAAGA
TTCTAAATGAGAGTTAAAATTAAATATTCTAACAGATTTTGGGAAGATTTACTTTTAGGA
TTAATTGGAAATCAATGCGAATTCAATAGCTACATCAATGGTATTTCTCTTCAAGCAAAA
GATCCTTAGCACATTGTTATTTAAATTTGGGTGAAAGATAGAAATAAAAACGAATCTATT
GACACAGGTATTAAAAACTTCATAATGAGTATTTATCAGTTGAATGAAGATTCATCTATC
GAGTACAGAGATTTTGCCAAGCAAAAAAAGTGA


>TTHERM_00583420(protein)
MSMKLSRGYTFWFVSERVENKDNYVSQLKKIGSFSDVDDFWKYYQHMARPDKLPEGTTFY
CFTEGVMPMWEDAANVGGGRFQMRVKIKYSNRFWEDLLLGLIGNQCEFNSYINGISLQAK
DPQHIVIQIWVKDRNKNESIDTGIKNFIMSIYQLNEDSSIEYRDFAKQKK


>TTHERM_00583420(gene)
ATGTCTATGAAGCTTTCAAGAGGATACACCTTTTGGTTTGTTTCCGAAAGAGTTGAAAAT
AAAGATAATTATGTTAGTTAGCTTAAAAAAATTGGATCATTTAGTGATGTTGATGATTTT
TGGAAATATTATTAGCATATGGCAAGACCTGATAAATTACCAGAAGGTACTACTTTTTAT
TGTTTTACCGAAGGAGTTATGCCAATGTGGGAAGACGCTGCAAATGTTGGTGGAGGAAGA
TTCTAAATGAGAGTTAAAATTAAATATTCTAACAGATTTTGGGAAGATTTACTTTTAGGA
TTAATTGGAAATCAATGCGAATTCAATAGCTACATCAATGGTATTTCTCTTCAAGCAAAA
GATCCTTAGCACATTGTTATTTAAATTTGGGTGAAAGATAGAAATAAAAACGAATCTATT
GACACAGGTATTAAAAACTTCATAATGAGTATTTATCAGTTGAATGAAGATTCATCTATC
GAGTACAGAGATTTTGCCAAGCAAAAAAAGTGA