Identifiers and Description

Gene Model Identifier

TTHERM_00736470

Standard Name

CDC23 (subunit of anaphase promoting complex)

Aliases

PreTt25472 | 120.m00130

Description

Anaphase promoting complex subunit 8 / cdc23 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

  • regulation of mitotic metaphase/anaphase transition (IEA) | GO:0030071

Domains

  • ( PF01535 ) PPR repeat
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF04049 ) Anaphase promoting complex subunit 8
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00736470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10630.19.997093137033517e-262anaphase promoting complex sub
unit 8/cdc23 family protein (6
88 aa)
OxytrichaContig18641.0.g692.998539800509618e-166Tetratricopeptide repeat
DictyBaseDDB_G02727757.999180615857794e-98anapc8 on chromosome: 2 positi
on 2162746 to 2164524
SGDYHR166C6.9991332754409754e-68CDC23 Subunit of the Anaphase-
Promoting Complex/Cyclosome (A
PC/C), which is a ubiquitin-pr
otein ligase required for degr
adation of anaphase inhibitors
, including mitotic cyclins, d
uring the metaphase/anaphase t
ransition
WormBaseWBGene000031345.002115178225629e-63locus:mat-3 status:Partially
_confirmed UniProt:Q19294
protein_id:CCD69151.1
Stentor CoeruleusSteCoe_6742.138865964899539e-62

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00736470(coding)
ATGCAACACAATTAGCAGCCAAACATTTTTGAATAACCTAACTACTTTTATTAAGATAAG
ATTTTCGTAAAGCTTCCTAATTTGGAAGTTTTAAGAGCAGAATTGAGATATGCTAGTTAA
TATCTCTCAGCACACAAGCTCTATCACAGTGCCAAATGGGCAAGCGAACTCTTATTAGGA
GTTACAAAGCAATCAGAAATATAAGATAGCGTTTTGCTAAATAATTTCATCATAAGCAAT
ATTGATAGCAATTACAAGTTTGCTAAAGTTTATTAAGAGCCCAGCGATGAAACTTTCGAA
GCCCTTTTGGTTGCTAGAAACTTATTTGACTTGAGAGAATTTAAAAAATGTGCACATATA
TTGAAAGACTATGCATAAAATCCAAAATACTAATAATGTATTTTCTTATATTACTATGCT
CTTTATATGGCAGGAGAAATTAGAAAGGAGGAGGAGATGTTTGAAGAAGAATAAAGTTCT
AAGAGGGTTGTCAATCCAGAATTAAGTTTAATTTATCGCGACTTGGATTAAATGTACAAA
AAGGGTGATCTTTGTGATGTAAATAGGTATTTATATGGATTGGTCCTCAAAGATTAGGAA
AGAACTGAAGAAGCCCGTTAGGTATTTTTAGGAGTTTTAAATGATTTTCCTTGCTTTTGG
TCAGCATGGATAGAGCTCTGCAAATTAATTCAAACAGAAGATATAAAGTTTTTGGATTTC
AAAGAGCATTGGATGAAGAATTTCTTCTACAGTAGTTTCTGCTTGGAAAAGCACAAAAGC
AATATTTGCATTGAAATCAATTATGGATTGCTGTGCTTTTTTAAAAATTCAAATTATTTA
ATAAACTAAATAGCCCACTACTTTTACAACTCATAAGATTTCGATATTTCGCTAGAGTGG
TTTGAAAAGCTTGTAGAAATAGACCCTTTTAGATACGAAAATATGGATACCTACAGTAAT
ATTCTCTATATTAAAGAAAACTAAGGTGAATTAGCCAATCTAGCCTTAAGATGTTTCTAC
AATAATAAGTATGCAACAGAAACATGTTGTGTAGTAGGTAATTATTACTCTCTGATGGGT
GAGCACTTAAAGGCAGTTAATTATTTCAGAAAAGCACTTAGATTAGATAGAAATTGTCTA
GCTGCTTGGACACTTATGGGACATGAATATTTAGAAATGAAGAATATTCCTGGTGCTATT
GAAGCTTACAGAAACGCTGTAGAAATAGATCCAAAAGATTTTAGAGCTTGGTATGGATTA
GGATAGACTTATGAACTTCAATCTATGAATCATTACGCTTTGTATTATTTCACTAGAGCA
GTTATGTCAAGACCAAAAGATTCTCGTATGTGGAATGCTATGGGTAATTGTTATGAAAAA
TTGAATAAGAAAAACGAAGCAACTCGTTGTTATGAAAGAGCTGAGAATGGCAAAGATAAA
GAAGGGATCGCTCTTTTCTAGATGGGTAAATTATATGATTTAATGGGATTCGAAGAAAGA
GCTATCCAGTGCTTTGAAGAGAATTTAAAAAGAAAGGATGAAGAAGAAACAGTTGACAAA
GAACTAGGAGAATGTCTTCTAATGTTGGCTAATCATCATAAGAAGAAATTAAATTTTGAA
AAAGCCCACTTCTATGCTAGAAGGTTGCTTGATATAAATGGCGCAGAAAGGGATGAAGCG
AATTAGATAATACATGAAATAAATTAAATGATGAACTAGTAATAGGTTTATTAGCAAAAG
CAGACACAATAAATTTAATAATAATAAATATATCAGTAAGCAGGAGGTTTTCTTCCTAAG
TATGGTTAATAAGCAAGTGGATTGAAAGGATTTTCTGTTTCATCTACTGTATAGCAACCA
ATACCTGGCTAACCTTAGATCCCTAATTTAATTCTTTAGCAATAGCATTTGACTCCTCAG
CAATAGTAATAATAATAGCTACTATAATAGTCATCTTCTGCATCATCAGCTAATTCTTCT
CAATAGCAAAACAAATACATTCCAAATATAACTGGATTTAATTTATCAGAGTTTTGA


>TTHERM_00736470(protein)
MQHNQQPNIFEQPNYFYQDKIFVKLPNLEVLRAELRYASQYLSAHKLYHSAKWASELLLG
VTKQSEIQDSVLLNNFIISNIDSNYKFAKVYQEPSDETFEALLVARNLFDLREFKKCAHI
LKDYAQNPKYQQCIFLYYYALYMAGEIRKEEEMFEEEQSSKRVVNPELSLIYRDLDQMYK
KGDLCDVNRYLYGLVLKDQERTEEARQVFLGVLNDFPCFWSAWIELCKLIQTEDIKFLDF
KEHWMKNFFYSSFCLEKHKSNICIEINYGLLCFFKNSNYLINQIAHYFYNSQDFDISLEW
FEKLVEIDPFRYENMDTYSNILYIKENQGELANLALRCFYNNKYATETCCVVGNYYSLMG
EHLKAVNYFRKALRLDRNCLAAWTLMGHEYLEMKNIPGAIEAYRNAVEIDPKDFRAWYGL
GQTYELQSMNHYALYYFTRAVMSRPKDSRMWNAMGNCYEKLNKKNEATRCYERAENGKDK
EGIALFQMGKLYDLMGFEERAIQCFEENLKRKDEEETVDKELGECLLMLANHHKKKLNFE
KAHFYARRLLDINGAERDEANQIIHEINQMMNQQQVYQQKQTQQIQQQQIYQQAGGFLPK
YGQQASGLKGFSVSSTVQQPIPGQPQIPNLILQQQHLTPQQQQQQQLLQQSSSASSANSS
QQQNKYIPNITGFNLSEF


>TTHERM_00736470(gene)
ATGCAACACAATTAGCAGCCAAACATTTTTGAATAACCTAACTACTTTTATTAAGATAAG
ATTTTCGTAAAGCTTCCTAATTTGGAAGTTTTAAGAGCAGAATTGAGATATGCTAGTTAA
TATCTCTCAGCACACAAGCTCTATCACAGTGCCAAATGGTAATAAACAGAATTATCTTCA
CTTTTTGGAATACTTTATTATTGACTATCAATTTAGCAATTTTTTTGATTGTTTTTTTCA
ATTATTTAATGAATAGGGCAAGCGAACTCTTATTAGGAGTTACAAAGCAATCAGAAATAT
AAGATAGCGTTTTGCTAAATAATTTCATCATAAGCAATATTGATAGCAATTACAAGTTTG
CTAAAGTTTATTAAGAGCCCAGCGATGAAACTTTCGAAGCCCTTTTGGTTGCTAGAAACT
TATTTGACTTGAGAGAATTTAAAAAATGTGCACATATATTGAAAGACTATGCATAAAATC
CAAAATACTAATAATGTATTTTCTTATATTACTATGCTCTTTATATGGCAGGAGAAATTA
GAAAGGAGGAGGAGATGTTTGAAGAAGGTAAAATTTCTATTTTAATTAAAATTGCAAATA
GCAAAAATGATTATTTAGACATTTAAAAATAAAAGAGATAAGAATTCTTTAAATATTGTA
AAGTATATGCAAAAAATATGAAAATATATTAGAGAGAATGTTTAGGATCGAAATTTTTTT
AATTATTTTTTTATCTATGAATCAGAATAAAGTTCTAAGAGGGTTGTCAATCCAGAATTA
AGTTTAATTTATCGCGACTTGGATTAAATGTACAAAAAGGGTGATCTTTGTGATGTAAAT
AGGTATTTATATGGATTGGTCCTCAAAGATTAGGAAAGAACTGAAGAAGCCCGTTAGGTA
TTTTTAGGAGTTTTAAATGATTTTCCTTGCTTTTGGTCAGCATGGATAGAGCTCTGCAAA
TTAATTCAAACAGAAGATATAAAGTTTTTGGATTTCAAAGAGCATTGGATGAAGAATTTC
TTCTACAGTAGTTTCTGCTTGGAAAAGCACAAAAGCAATATTTGCATTGAAATCAATTAT
GGATTGCTGTGCTTTTTTAAAAATTCAAATTATTTAATAAACTAAATAGCCCACTACTTT
TACAACTCATAAGGTAAACAAATAACTATCTGAAAATATTCTAATTTATATTTTGTTAAA
TAATTTAGATTTCGATATTTCGCTAGAGTGGTTTGAAAAGCTTGTAGAAATAGACCCTTT
TAGATACGAAAATATGGATACCTACAGTAATATTCTCTATATTAAAGAAAACTAAGGTGA
ATTAGCCAATCTAGCCTTAAGATGTTTCTACAATAATAAGTATGCAACAGAAACATGTTG
TGTAGTAGGTAAACTATCATAAATAGATATTTTTGTTAAACGAAATTAATTCATATTTAA
TAAAACAATTTATTTCAATTTATTCTAAAAGCGAACCAAGTATACAATCAAACTAAAATA
GTGAATTTTCAATTAATTAATAATTTAACTTTAATTATAAATAAAAATGGTAAAAAAAGA
AATAAAAAACAAAGATTTTTACTAACAAAATAAAGGATATTTATTATAAAGCTAATACTG
AATAGCAAAAATCAAGAAATATTCTGATTGATATTTAATTCATTCAGATATTTATGATAA
AACTAAAAATTAGTCATGAGATTTAATAATTTTTTTTGATAAAAAAAAGAAATTGCAAAT
TATTTATTTAATCAATTTCTTGATTTTTCAAACATAAAAGATCAAATTTTTTATCAATTT
ATTGATTTTTCAAACATAAAAAGATCAAATTTTTAATCAAAAATAATTAATCAAATTATT
AATAAAAAAAAAATAAATCAAATTATTAATAAATATTCATTAATTTTAACTTTAATTTGA
AAATACTTATTTTATTTATGAAATTAATTAATTTTTATTTAAAACACACAAAACATTTTA
TTGAATTTGTAAAAATAATAATTTTACTTAATACCTAATAAAGGTAATTATTACTCTCTG
ATGGGTGAGCACTTAAAGGCAGTTAATTATTTCAGAAAAGCACTTAGATTAGATAGAAAT
TGTCTAGCTGCTTGGACACTTATGGGACATGAATATTTAGAAATGAAGAATATTCCTGGT
GCTATTGAAGCTTACAGAAACGCTGTAGAAATAGATCCAAAAGATTTTAGAGCTTGGTAT
GGATTAGGATAGACTTATGAACTTCAATCTATGAATCATTACGCTTTGTATTATTTCACT
AGAGCAGTTATGTCAAGGTGATTAGTTAGATCAAGATTAAATCTAAATAGTTTTCTAATA
ATATTTATTTTCTTTTTAAAAATAGACCAAAAGATTCTCGTATGTGGAATGCTATGGGTA
ATTGTTATGAAAAATTGAATAAGAAAAACGAAGCAACTCGTTGTTATGAAAGAGCTGAGA
ATGGCAAAGATAAAGAAGGTATTTTAATTAATTATTTATTTTTTTTACCTTTATTGTAAT
AAAAATATTTTTTAATTATTGGATTTTTAAAGGGATCGCTCTTTTCTAGATGGGTAAATT
ATATGATTTAATGGGATTCGAAGAAAGAGCTATCCAGTGCTTTGAAGAGAATTTAAAAAG
AAAGGATGAAGAAGAAACAGTTGACAAAGAACTAGGAGAATGTCTTCTAATGTTGGCTAA
TCATCATAAGAAGAAATTAAATTTTGAAAAAGCCCACTTCTATGCTAGAAGGTTGCTTGA
TATAAATGGCGCAGAAAGGTAAAATGAATGAAATTTTTATATTTTAATGTTCAAATTGTA
TGTTTTTAATGAATGAGCAAAGAAAATAGATAGTGTTTAAATAATTAAAAATCCAAACAA
ATTTGGGTTTAAAAAATAGTTTTCAGAATGCTAAAAAAAACAGGATAGAATTAATTTTTA
TTTGAAATAAAATAGGGATGAAGCGAATTAGATAATACATGAAATAAATTAAATGATGAA
CTAGTAATAGGTTTATTAGCAAAAGCAGACACAATAAATTTAATAATAATAAATATATCA
GTAAGCAGGAGGTTTTCTTCCTAAGTATGGTTAATAAGCAAGTGGATTGAAAGGATTTTC
TGTTTCATCTACTGTATAGCAACCAATACCTGGCTAACCTTAGATCCCTAATTTAATTCT
TTAGCAATAGCATTTGACTCCTCAGCAATAGTAATAATAATAGCTACTATAATAGTCATC
TTCTGCATCATCAGCTAATTCTTCTCAATAGCAAAACAAATACATTCCAAATATAACTGG
ATTTAATTTATCAGAGTTTTGA