Identifiers and Description

Gene Model Identifier

TTHERM_00327340

Standard Name

CDC16 (subunit of anaphase promoting complex)

Aliases

PreTt30237 | 33.m00249 | 3705.m00077

Description

TPR Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08238 ) Sel1 repeat
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF07721 ) Tetratricopeptide repeat
  • ( TIGR00213 ) D,D-heptose 1,7-bisphosphate phosphatase
  • ( PF01239 ) Protein prenyltransferase alpha subunit repeat
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR00990 ) mitochondrial precursor proteins import receptor
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00327340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08574.19.997093137033517e-262TPR Domain containing protein
(867 aa)
OxytrichaContig17304.0.g246.99920276797163e-121TPR repeat
SGDYKL022C6.998316056150599e-49CDC16 Subunit of the anaphase-
promoting complex/cyclosome (A
PC/C), which is a ubiquitin-pr
otein ligase required for degr
adation of anaphase inhibitors
, including mitotic cyclins, d
uring the metaphase/anaphase t
ransition; required for sporul
ation
DictyBaseDDB_G02862333.000555717977434e-27anapc6 on chromosome: 4 positi
on 4222260 to 4225138
WormBaseWBGene000012811.9994498063102785e-22locus:emb-27 status:Confirme
d UniProt:G5EG38 protein_i
d:CAA88313.1
Stentor CoeruleusSteCoe_104240.00000001522997974471263

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00327340(coding)
ATGTCATAATCTAGCGGATAGAAACCAACAAGCATAGGATTATAGCAAGGTTAGCAGTAG
CAATATCCATAGTAAAGTTAATCAGTTAATTCGTAGTAGTCTTCGATTTTTTCAGGTTTG
CAAGCAGGATCAAGCGCTTCTCCTTCAATAAATAATTTCTTTACTTCTTCAAACATTCAT
AACATAGGATAAATCTAAAATGCAGGTACTTAGTAATAAGCTCAAGTCCAACAAAGTTCA
AATAACTTAATTGGTACGAGTTAAATTCCTAATACAATTCCTGCATCTTAAGTTCCTATT
AATCGCTTTGGGAGAGGCAGTTTCCGTCGTGGGGACAAAGAGTCAAAAACGTATTTGCAA
GAAATTTATGGACCATACTATTTGAATTGTGAATAAAATATTGAGGAAATAAAGGCAACA
GGAAGTGTTTTAGGAAATTCAGGTATTTCTGTCAATTATGGATAGCAAATCTAGTAAAAA
TTGTTTTAAGAGTGCTTAGAAAATGAGAATATTTGGAAACTCTATGAACTAGTAATTGAA
AATAAGTCTATGCATTCATGGACAGACGCAATTTTTTATGCTGATAAATTAATCACCTTA
ACTGATGGACTAGCACCTTTTGTATATTTACTTGGAGAATGCTATTTCTTAAATGGAGAT
TATAAAAAGGTCCATTCTCTTTTTGCTAAATATAAATTAATTAGCTATAATTCTCATTTT
ACGATACTTGCTGCTAAAGCATTATACAAAAATAAATAGTATGAATAATGCTTAAATTTA
CTTGAATAAGCTTAGGAGCAGTAAGTAGCTTCCTTAGCATAGCAAGGCCCTTCTTCTTTC
AATTACTAAGGCTCAACTTCTGCTTAGGGTATTCCTGTTGGATCTAACTTAAATAATCCA
AATTAAGGTTTAGGTGCAAGTACTTTTGGATAGCAATAAGTTGGAGGCCAGCAATTTAAC
AATATTCATCAATAGTTTGGACATAATTTGCATCATAGCCAGAATACTTTCCTTCACTAA
CAATAATAAAATCAGTCATAGCAATAATAGATGAAAAATTAGAATAAGTTAGAAGCTTAA
AAGCATCTATTAAAGGGATTGTGTTATGAAGCAAGCGAAAATAAATAAAACGCAGTTAGT
TCTTACATGGAATGCCTAAAGCGCGATCCAACTTGTCATGAAGCTTTCAAAAGAATGATA
GATTTTTATTTATTAGGATCAACTGGTAAAGAATAACTCCTTACTTCTTTGAATTTCAAT
CCTGAAGATATTTGGATAAAATAATATTATATAGCTAGAATCAGTGAAGATACTGCTTGT
AAATTAGATATTTAAAAAGGAATGGATGAAGAGTTACCATCATCAGTAATAGGAAGCGAT
AAATCAGAAGTGATCATGAAGGATCCTAGTGGTGCAGGTATTGGAGGAGTAACAGTTCCT
GGAAATGTCAACAATGACCCCAAAGCTTAAATTAGAATTTAAAATTTATTGGAAAGATTA
AGACCTGAAAATTTATTTGAAACCTTGTCTTAAAAGAATAATATTGATTTACTTTGCATT
AAAGCAAAAAATTGTCATGCTAAGTATGATATTTAAAAAGCCTATGATATATGCATAAAA
GCAATTAAAATTGATCCATTATATTTTGACATAATACCTGTATATTGCGCTTGTTTACTT
CATCTCAACTATCTGGGTGAATTGTACTACTGTGCCCACAATCTAGTAGAAAATTACTCA
ACACATCCATTAAGTTGGTTTGCTATTGGTACTTATTATTATTTGACTAAAAAATATGAA
GTAGCAAGAAAGTATTTCTAAAAAGCTATCTATTTGGATAGAAATTTTGTTTATGCATGG
ATTGGTATGGCTCACTCTTTTGCAATTTAAGACGAGTCTGACTAAGCTATGAGCTTTTAC
AGAACTGTAAGCAGACTCTTCCCAGGTTGCTATTTAGCTCACTTGTACATGGGTATGGAA
TACTTAAGAACTAATAACCTTAAAACAGCTCTACTTTCCTTCTAATATGCAAAAGAAATC
AACAGTAATGATCCTCTTATTTACAACGAAATAGGTGTAATCTATTTTAAGTAGAAAGCC
TATGAAGAAGCAAAGCAAAAGTACTTGCAAGCTATGAATTTGTGTACTGAAGCAACTAAT
TCGATAGTTCATACCATTTTAAACAATCTGGCTCATACCTGTAGAAAAATGAAAGATTAT
AAATCTGCTATTTAATATTATGAAAGATGCATTCAGTTAGAGCCTAAAAATTATCAAACA
TATTTTTCTTTGGCATACACTTATCATATATCAAACCAATTGAATAAAGCTATAGCTTAT
TATCATAAATCTTTATATTACAAGCATGAAAACCAATTTGCTTTTGACATGCTTGATAGA
TGCCTTAAAGATGCTTCAGAGTATCCTTGGGAAAGTGTATACGAAGCTAAAAATGAATGA


>TTHERM_00327340(protein)
MSQSSGQKPTSIGLQQGQQQQYPQQSQSVNSQQSSIFSGLQAGSSASPSINNFFTSSNIH
NIGQIQNAGTQQQAQVQQSSNNLIGTSQIPNTIPASQVPINRFGRGSFRRGDKESKTYLQ
EIYGPYYLNCEQNIEEIKATGSVLGNSGISVNYGQQIQQKLFQECLENENIWKLYELVIE
NKSMHSWTDAIFYADKLITLTDGLAPFVYLLGECYFLNGDYKKVHSLFAKYKLISYNSHF
TILAAKALYKNKQYEQCLNLLEQAQEQQVASLAQQGPSSFNYQGSTSAQGIPVGSNLNNP
NQGLGASTFGQQQVGGQQFNNIHQQFGHNLHHSQNTFLHQQQQNQSQQQQMKNQNKLEAQ
KHLLKGLCYEASENKQNAVSSYMECLKRDPTCHEAFKRMIDFYLLGSTGKEQLLTSLNFN
PEDIWIKQYYIARISEDTACKLDIQKGMDEELPSSVIGSDKSEVIMKDPSGAGIGGVTVP
GNVNNDPKAQIRIQNLLERLRPENLFETLSQKNNIDLLCIKAKNCHAKYDIQKAYDICIK
AIKIDPLYFDIIPVYCACLLHLNYLGELYYCAHNLVENYSTHPLSWFAIGTYYYLTKKYE
VARKYFQKAIYLDRNFVYAWIGMAHSFAIQDESDQAMSFYRTVSRLFPGCYLAHLYMGME
YLRTNNLKTALLSFQYAKEINSNDPLIYNEIGVIYFKQKAYEEAKQKYLQAMNLCTEATN
SIVHTILNNLAHTCRKMKDYKSAIQYYERCIQLEPKNYQTYFSLAYTYHISNQLNKAIAY
YHKSLYYKHENQFAFDMLDRCLKDASEYPWESVYEAKNE


>TTHERM_00327340(gene)
ATGTCATAATCTAGCGGATAGAAACCAACAAGCATAGGATTATAGCAAGGTTAGCAGTAG
CAATATCCATAGTAAAGTTAATCAGTTAATTCGTAGTAGTCTTCGATTTTTTCAGGTTTG
CAAGCAGGATCAAGCGCTTCTCCTTCAATAAATAATTTCTTTACTTCTTCAAACATTCAT
AACATAGGATAAATCTAAAATGCAGGTACTTAGTAATAAGCTCAAGTCCAACAAAGTTCA
AATAACTTAATTGGTACGAGTTAAATTCCTAATACAATTCCTGCATCTTAAGTTCCTATT
AATCGCTTTGGGAGAGGCAGTTTCCGTCGTGGGGACAAAGAGTCAAAAACGTATTTGCAA
GAAATTTATGGACCATACTATTTGAATTGTGAATAAAATATTGAGGAAATAAAGGCAACA
GGAAGTGTTTTAGGAAATTCAGGTATTTCTGTCAATTATGGATAGCAAATCTAGTAAAAA
TTGTTTTAAGAGTGCTTAGAAAATGAGAATATTTGGAAACTCTATGAACTAGTAATTGAA
AATAAGTCTATGCATTCATGGACAGACGCAATTTTTTATGCTGATAAATTAATCACCTTA
ACTGATGGACTAGCACCTTTTGTATATTTACTTGGAGAATGCTATTTCTTAAATGGAGAT
TATAAAAAGGTCCATTCTCTTTTTGCTAAATATAAATTAATTAGCTATAATTCTCATTTT
ACGATACTTGCTGCTAAAGCATTATACAAAAATAAATAGTATGAATAATGCTTAAATTTA
CTTGAATAAGCTTAGGAGCAGTAAGTAGCTTCCTTAGCATAGCAAGGCCCTTCTTCTTTC
AATTACTAAGGCTCAACTTCTGCTTAGGGTATTCCTGTTGGATCTAACTTAAATAATCCA
AATTAAGGTTTAGGTGCAAGTACTTTTGGATAGCAATAAGTTGGAGGCCAGCAATTTAAC
AATATTCATCAATAGTTTGGACATAATTTGCATCATAGCCAGAATACTTTCCTTCACTAA
CAATAATAAAATCAGTCATAGCAATAATAGATGAAAAATTAGAATAAGTTAGAAGCTTAA
AAGCATCTATTAAAGGGATTGTGTTATGAAGCAAGCGAAAATAAATAAAACGCAGTTAGT
TCTTACATGGAATGCCTAAAGCGCGATCCAACTTGTCATGAAGCTTTCAAAAGAATGATA
GATTTTTATTTATTAGGATCAACTGGTAAAGAATAACTCCTTACTTCTTTGAATTTCAAT
CCTGAAGATATTTGGATAAAATAATATTATATAGCTAGAATCAGTGAAGATACTGCTTGT
AAATTAGATATTTAAAAAGGAATGGATGAAGAGTTACCATCATCAGTAATAGGAAGCGAT
AAATCAGAAGTGATCATGAAGGATCCTAGTGGTGCAGGTATTGGAGGAGTAACAGTTCCT
GGAAATGTCAACAATGACCCCAAAGCTTAAATTAGAATTTAAAATTTATTGGAAAGATTA
AGACCTGAAAATTTATTTGAAACCTTGTCTTAAAAGAATAATATTGATTTACTTTGCATT
AAAGCAAAAAATTGTCATGCTAAGTATGATATTTAAAAAGCCTATGATATATGCATAAAA
GCAATTAAAATTGATCCATTATATTTTGACATAATACCTGTATATTGCGCTTGTTTACTT
CATCTCAACTATCTGGGTGAATTGTACTACTGTGCCCACAATCTAGTAGAAAATTACTCA
ACACATCCATTAAGTTGGTTTGCTATTGGTACTTATTATTATTTGACTAAAAAATATGAA
GTAGCAAGAAAGTATTTCTAAAAAGTAAATTTTATTTATTAGCTTATAATTTAAATGAAT
AGATTTATTTTTTAAGCTTCAATTAAATAGATTCTGCATTTTAACAAAAATTAAACCTTG
CATTTTTTACTAAAAAAGCTTAAATTATTAATTTAAAAAGTCTTAGTATTTTAAAATTTT
TAAATTAGCAATATAAATTAATACTTTTGGCATTTTAGGCTAATATTTTATAATTAATGG
CCAAAAGAAAGACATCTTAAATTAACAAAATTTTTTTTATTTAACCTGGAATTAAAAATT
TAATAGCTCAATATTTAAGAATAGCTATGAAAACTAATTCATAAAAATTTTTTTAAAGCT
TAATTATTGCTAGCTTAATATAATATCCTGAAATCTTCTTTTTTTTTATAATAAATTAAC
TTGAGATAGCTAATAATTTAAATTCCTAGGTTATTATTATCAATAAATGAGATGACTAAA
GTTGAAAATTTGAATTAGAAAATTTATTATTACCAGTAAAAAAATTAATGAAAATTTTTA
ATATTTTTAATATTATTATGATATACAAAATAATTATTTTTATTTACTACTAATTTTAAG
ATTATTGAATCATAAAAATTTTATTTTTTATTATTTTAGAATTTATTTTATTTTAATAGA
TATTTTTTAAGAAATAGAGAATAAAATTAAATAATGAAAAGATTAAATAAATATTTTTCA
ATAATTTAAAACAAAATTAGTAAGAGATAAATAAAAAATAAGTTTACATATTTAATTTGT
ATTTCTTGCCCATTAGAAATAAAATTGACTAGATTTAATGATTTATGAGATAGAATAGGC
ATATTATTTTAATATTAATTTTATATTACCTTTAAAATTAAAAAATATTTCTACAATTAG
CTTTTAATAAAAGAAAAATAAACGTAAACAGAGATTTTATTTCTTTTCTATACTTTTTTT
AATTTCTTCATTATCTTTGCTTGAAAGAAAATAGGAATTTTTTTTAAATTGATTCTCCTT
TGAATGCAATAACGAAACAAAATTATTTTTTTATAATCAAGATGATAATTTTAATTTTTT
ATAACCTTTCTTTTATAAAAAGGCTATCTATTTGGATAGAAATTTTGTTTATGCATGGAT
TGGTATGGCTCACTCTTTTGCAATTTAAGACGAGTCTGACTAAGCTATGAGCTTTTACAG
AACTGTAAGCAGACTCTTCCCAGGTTGCTATTTAGCTCACTTGTACATGGGTATGGAATA
CTTAAGAACTAATAACCTTAAAACAGCTCTACTTTCCTTCTAATATGCAAAAGAAATCAA
CAGTAATGATCCTCTTATTTACAACGAAATAGGTAAAATTAAAAAAATCAATGAAATATT
AAAATTTCAAATTCAAAAATAAAGACAATTAATTTTGATCATTCAATTTTTTATTACTTA
ATTAATTTTCTCAAAATTAATTAAACCTTTGGAATTCGATCAAATTTAGTATTTTAATAA
TTTCAATTCAATTAATCCATTATTTTTGAGATCGAATATAAATTTTTTAACAATGAATTT
ATTTTTGGTTTTTAATAGTCTACAGAATACTAAAACATTTAGATTACTTTGAATATGTAA
CTTAATAAAAGTGAATTTGATAATAATTATTTATCCTTTTTAATGTTTCTATTAAAAAAA
GAAAATATCTTATTTTTTCTTTTAAATTAAAGGTGTAATCTATTTTAAGTAGAAAGCCTA
TGAAGAAGCAAAGCAAAAGTACTTGCAAGCTATGAATTTGTGTACTGAAGCAACTAATTC
GATAGTTCATACCATTTTAAACAATCTGGCTCATACCTGTAGAAAAATGAAAGATTATAA
ATCTGCTATTTAATATTATGAAAGATGCATTCAGTTAGAGCCTAAAAATTATCAAACATA
TTTTTCTTTGGCATACACTTATCATATATCAAACCAATTGAATAAAGCTATAGCTTATTA
TCATAAATCTTTATATTACAAGCATGAAAACCAATTTGCTTTTGACATGCTTGATAGATG
CCTTAAAGATGCTTCAGAGTATCCTTGGGAAAGTGTATACGAAGCTAAAAATGAATGA