Identifiers and Description

Gene Model Identifier

TTHERM_00013410

Standard Name

CDA12 (Cell Division Arrest )

Aliases

PreTt11847 | 1.m00895

Description

Golgi-associated protein; required for cytokinesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00013410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_363690
Tetrahymena borealisEI9_02704.16.9991332754409754e-68hypothetical protein (174 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19286988: Zweifel E, Smith J, Romero D, Giddings TH, Winey M, Honts J, Dahlseid J, Schneider B, Cole ES (2009) Nested genes CDA12 and CDA13 encode proteins associated with membrane trafficking in the ciliate Tetrahymena thermophila. Eukaryotic cell 8(6):899-912

Sequences

>TTHERM_00013410(coding)
ATGCAATACGAACAACTAAACCAAATAAACCCACAACTCGGTGGTAACAACGATTCTGCT
TGGGGCAAAGATCTTATAATCGTCATCTTTTATGGTATTTTCGGTGGTTTGTTCTATGCA
TTTTCAACAAATCCTGAGAGATATTCTAAATGCGATGATAGCCAATTTATAGATTGGACC
AAATTAACTATGATTGTTTGTCTTTCTTATACTGCTGTTTCTTTAATCAAACTTCCTTTG
TATATCTGCAAATTGACTTAGAAGTGTCCTACTCTTTGGTCTTCTCTTGAAGCAGTTGGC
GGTATTTTTGTAATCATTTGTGGAATTGGTTTAACTGTAAAGGATAACAAAAGTTGTGGA
GAATTGCATACATTAGCTATGGTTTTCTATATTCTTGTCTACATTAGTCTTGGTATTTTA
GGATTGGTTATTTGCTGCTCTTGCATCTGCTGTGCTGGAATGGTTGCTAGCGCTTCTATG
CAAAAGACAGATGATTTAGAAGGCAAACCCATGAATAACGATACCGCTCCCCAATATGAT
GGTTAATTATGA


>TTHERM_00013410(protein)
MQYEQLNQINPQLGGNNDSAWGKDLIIVIFYGIFGGLFYAFSTNPERYSKCDDSQFIDWT
KLTMIVCLSYTAVSLIKLPLYICKLTQKCPTLWSSLEAVGGIFVIICGIGLTVKDNKSCG
ELHTLAMVFYILVYISLGILGLVICCSCICCAGMVASASMQKTDDLEGKPMNNDTAPQYD
GQL


>TTHERM_00013410(gene)
ATGCAATACGAACAACTAAACCAAATAAACCCACAACTCGGTGGTAACAACGATTCTGCT
TGGGGCAAAGATCTTATAATCGTCATCTTTTATGGTATTTTCGGTGGTTTGTTCTATGCA
TTTTCAACAAATCCTGAGAGATATTCTAAATGCGATGATAGCCAATTTATAGATTGGACC
AAATTAACTATGATTGTTTGTCTTTCTTATACTGCTGTTTCTTTAATCAAACTTCCTTTG
TATATCTGCAAATTGACTTAGAAGTGTCCTACTCTTTGGTCTTCTCTTGAAGCAGTTGGC
GGTATTTTTGTAATCATTTGTGGAATTGGTTTAACTGTAAAGGATAACAAAAGTTGTGGA
GAATTGCATACATTAGCTATGGTTTTCTATATTCTTGTCTACATTAGTCTTGGTATTTTA
GGATTGGTTATTTGCTGCTCTTGCATCTGCTGTGCTGGAATGGTTGCTAGCGCTTCTATG
CAAAAGACAGATGATTTAGAAGGCAAACCCATGAATAACGATACCGCTCCCCAATATGAT
GGTTAATTATGA