Identifiers and Description

Gene Model Identifier

TTHERM_00037060

Standard Name

CCT8 (Chaperonin Containing TCP-1 ortholog 8)

Aliases

PreTt14441 | 2.m02183 | 3825.m02813

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00037060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_286890
Tetrahymena borealisEI9_00965.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (543 aa)
OxytrichaContig20390.0.g399.997093137033517e-262TCP-1/cpn60 chaperonin family
DictyBaseDDB_G02762332.999560593141819e-170cct8 on chromosome: 2 position
6265977 to 6267838
WormBaseWBGene000219341.9995739544551218e-152locus:cct-8 T-complex protei
n 1 subunit theta status:Par
tially_confirmed UniProt:Q9N
358 protein_id:CCD67240.1
SGDYJL008C5.9988791724737674e-136CCT8 Subunit of the cytosolic
chaperonin Cct ring complex, r
elated to Tcp1p, required for
the assembly of actin and tubu
lins in vivo

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037060(coding)
ATGTCCCTTGCCTCTGCTTACGGTATCAACAGTCTTCTTAAAGAAGGACACAAACATTTC
TCTGGTATGGAAGAAGCTCTTTTGAAGAACATTAATGCTTGCAAAGAAATCTCTAACATG
ACCAAGACCTCTCTCGGTCCCAATGGTATGAAGAAGATGGTTATCAACCACCTTGATAAG
ATTTTTGTTACTTCTGATGCTGCCACCATCATGCAAGAATTGGAAGTTCAACACCCTGCT
GCCAAAATGATCGTTATGGCTGCTAAGATGCAAGAAAACGAATGTGGTGATGCCACCAAC
TTAGTTATTGCTTTGGCTGGTGAACTCCTCAGTCAAGCTGAATCTTTAATTAAGATGGGT
CTCCACCCCTCTCAAATTATTGCTGGTTACGAAAAGGCTCTTAAGGCTACCGTATCCCTC
CTCCCCACTCTTTCCATTTACACCGTTGAAGATCCTACCAATTTGGAATAAGTTAACAAA
GCTATCAGAGCTTCTCTCTCCTCCAAGCTCATCCACCACGCTGACTTTTTCTCTAAGATT
GTTTCATAAGCCTGTATTAACAGTAAGCCTGAAAATGATGGAGAGTTTGATTTGGAATAC
GTCAGAGTTGCTAAGATTTTGGGTGCCTCTATTGATGACTCCTACGTCCAATAAGGTTTG
ATCATTACCAGAAGCTCTGAAGGCTCTATCACAAGAGTTACTAACCCCAAGGTTGCTGTT
TACTCTTGCCCTCTCGATACCCAACAAGCTGAAACTAAGGGAACTGTTTTAATTCAAAAT
GCTGAACAACTCCTTAATTACACTAAATCTGAAGAATCCCACGCTGAATCCATTGTCAAG
AAAATTGCTGATTCTGGTGTTAATTTTATCATTGCTGGTGGTTCCATCTCTGAAATCGTT
TTACATTACGTCGAAAAATATAAAATGATGATTGTTAAGTGCACTTCCAAGTTCGAATTA
AAGAGAATTTGCAAGGCTTTGGGTGCTTCTCCTGTTGCTAGATTAGATGCTCCTAATCCT
GAAGAAATTGGTTTCTGCGACTCTGCCTCAGTTGAAGAAATCGGTTCTCAAAAGGTCACC
ATTATTAAGAAGGAAAGCTCCGACTGCAAATTAAATACTATTGTTTTGAGAGGTTCTACC
CTTAACCTTTTGGACGATATTGAACGTGCTATTGACGATGGTGTCAATGTTTACAGATGT
CTCCTCAAGGACGGCAAGTTTGTCCCTGGTGCTGGTGCCACTGAAGCCATCTTATCATAC
AAGTTATAATCTGAAGCTAAGAGCTTAGAAGATCTCTCCCAATATGCTTTCAACAGATTT
GCTTTATCTTTTGAAATTATCCCCAGAATTTTGTCTGATAATGCAGGTTTGAACTCTAAC
GAAATCATCCCCAAGCTCAACACTGCCAATAAGGAAGAACCCCACGGTATTGATATTGAT
AATGGCTCTATTAAGAAATCCTCTGAATTAGCTGTCTATGACCACTTACAATCTAAGTTA
TGGGCTATTAGATTAGCTGCTGATGCTGCCATTACTATCCTTAAGGTTGATTAGGTAAAC
CCATTTAAATAATATTAATCACTACAAAAATAAATGAATTTGATTGAAAATATGCTTACT
TATTTTTGTTATTTTATAATAGATCGTAATTGCTAAGCAAGCTGGTGGTCCTAAGATGAA
CCAATAATAGGGTCACTGGGACGACTAAGAATGAGGAATTTGAGTAGTTTCAAAAATTAA
ATAGTAATAATCACAATAACAACAATAACAACTTTAATTCAATAACATAAATTTAATAAC
CAAATTATTTTATTTTTCATTAAAAATATAATATAACATAAATTTTGTAAGCAGATATGC
GACTTACAATTCTCAAATCAAATCACACTATCTATATCCTTCATTCATTTTTAACTTACA
AAAATTAACTTAATTTAAATATAGTTAGTTTTGATTTTAGTTGTTTTTAATTATATATTC
TATTTCAGTTTGAAAAATACTCTTATTCAGTTCTAAATAAATTCCATAAAATTCTGTTTG
TTTAATTATTCATTTATTTTTATTAAATTGTCTTTATTTTATTTTAATAAATAATTTCGT
AGAACATTTTTTTTTTCCATACTTTATTTTCGAAATATAAAAGATGAATTTAATTGTTTG
TTTTCATTTTTGATATATTTTATATTGCTATGTAAATCTTTAATGATTATAAATATTTAT
TTATTTATAATTTTAGATTTAAAAAACACTAAATTAACTAAATTTAATTTTTATAAATTA
AATAATTTTTTTATATTCTTCTCAAAAAAAAATAAAAATAAAGAAGATCATTTATTAAAT
AATTTTTTTTTAAAAATGTTTAAAATTGAGAATTAAATTAATTTTACTTTCAAATATGAA
AATTTAAAAATATGTAAAATTTAATGGTAAATCAACTAATAAATTAGCATTTATAATACA
ATTTTAATTTAATAATATCAATTATCAAAAAAATAATCTTATTTTTTAAGGTCTATAATA
AAATACATTTTTACTAAATAAGCGAAATTAAAAAGCTAAATATTTGAAATAAATTAATTT
ATTAAAAATAATTATAAAAATTGA


>TTHERM_00037060(protein)
MSLASAYGINSLLKEGHKHFSGMEEALLKNINACKEISNMTKTSLGPNGMKKMVINHLDK
IFVTSDAATIMQELEVQHPAAKMIVMAAKMQENECGDATNLVIALAGELLSQAESLIKMG
LHPSQIIAGYEKALKATVSLLPTLSIYTVEDPTNLEQVNKAIRASLSSKLIHHADFFSKI
VSQACINSKPENDGEFDLEYVRVAKILGASIDDSYVQQGLIITRSSEGSITRVTNPKVAV
YSCPLDTQQAETKGTVLIQNAEQLLNYTKSEESHAESIVKKIADSGVNFIIAGGSISEIV
LHYVEKYKMMIVKCTSKFELKRICKALGASPVARLDAPNPEEIGFCDSASVEEIGSQKVT
IIKKESSDCKLNTIVLRGSTLNLLDDIERAIDDGVNVYRCLLKDGKFVPGAGATEAILSY
KLQSEAKSLEDLSQYAFNRFALSFEIIPRILSDNAGLNSNEIIPKLNTANKEEPHGIDID
NGSIKKSSELAVYDHLQSKLWAIRLAADAAITILKVDQVNPFKQYQSLQKQMNLIENMLT
YFCYFIIDRNCQASWWSQDEPIIGSLGRLRMRNLSSFKNQIVIITITTITTLIQQHKFNN
QIILFFIKNIIQHKFCKQICDLQFSNQITLSISFIHFQLTKINLIQIQLVLILVVFNYIF
YFSLKNTLIQFQINSIKFCLFNYSFIFIKLSLFYFNKQFRRTFFFSILYFRNIKDEFNCL
FSFLIYFILLCKSLMIINIYLFIILDLKNTKLTKFNFYKLNNFFIFFSKKNKNKEDHLLN
NFFLKMFKIENQINFTFKYENLKICKIQWQINQQISIYNTILIQQYQLSKKQSYFLRSII
KYIFTKQAKLKSQIFEINQFIKNNYKN


>TTHERM_00037060(gene)
ATGTCCCTTGCCTCTGCTTACGGTATCAACAGTCTTCTTAAAGAAGTAAAATATTTAAAT
TATAAAACTGATTTTGTTGATAGCATGTCACTCATAGCCCATATTAAAGAATATTTTTCA
GCAATAAGTCTTCTAATTTCCATCAAAAATTCCAAATTTATTTAGCGATTTGGTTAAATA
GCATTCTCAATTTAAACTCAGCTATGTATGGACAAATTAAAAAAATCTAAAAGGATCCCA
CAATTTTTATTATAGAGACATAAAATTTAAATAGGAAAGTCTAAACAAATTTTAATAAAT
GAATAATAAGTCTTTAAAAATTAGTAGAATTAAATGTTGCCACAATTTATGAAAATTATT
TCTTTAACATATTTGATTTTGTTCATTAATTTCATAGAGGCTATCTTCAAAACTAGCAAA
TTTGATCATTTTATGTATTTATATATTTCTCATTACATTCAAAAGGGACACAAACATTTC
TCTGGTATGGAAGAAGCTCTTTTGAAGAACATTAATGCTTGCAAAGAAATCTCTAACATG
ACCAAGACCTCTCTCGGTCCCAATGGTAACTACTAATTAATAATTATAATTATAAAAAAC
TCAGCAAAATCAACAAAATTGTAGAGAGTAGTAAAGAACAACAAAATATTTATAGTAGCT
AAATCCATAAATATAATAAAAAAACATTTCAAATGAAGCAGAAAAAAAATAGGATATTAA
TTAGATGATTCTAAACATAAAAGATTAAAATCACTTCTTTTATAGATACATAAACTCTAC
AAGAAGCTTCTGCTTCTTCAAAAAGCACTTTTATATTAATTTATTGTTATGAATAATAGG
TATGAAGAAGATGGTTATCAACCACCTTGATAAGATTTTTGTTACTTCTGATGCTGCCAC
CATCATGCAAGAAGTAATTCATCTATTTTTTATTTGATTCCCTTAAAATTGTCATAAAGC
AATTAAGTAGACGAAATGATTCATATATAAGACAATAAATAAATAAATAAACAATTAATT
TTATTAGCCTATTTTAAAGCCAAAGCAATTAACTAATTTTATTATAAAGATGGCCTTAAA
AAATATATATTTTCCAACATAATTTAATTTGTATTCTAACAAAAACTACTTAATAATTAG
TTGGAAGTTCAACACCCTGCTGCCAAAATGATCGTTATGGCTGCTAAGATGCAAGAAAAC
GAATGTGGTGATGCCACCAACTTAGTTATTGCTTTGGCTGGTGAACTCCTCAGTCAAGCT
GAATCTTTAATTAAGATGGGTCTCCACCCCTCTCAAATTATTGCTGGTTACGAAAAGGCT
CTTAAGGCTACCGTATCCCTCCTCCCCACTCTTTCCATTTACACCGTTGAAGATCCTACC
AATTTGGAATAAGTTAACAAAGCTATCAGAGCTTCTCTCTCCTCCAAGCTCATCCAGTAA
CAAACAAATTTATAAATATTTTAATAAAATTTTTAACTAAACAATTCTTTTTATTTTAAT
AGCCACGCTGACTTTTTCTCTAAGATTGTTTCATAAGCCTGTATTAACAGTAAGCCTGAA
AATGATGGAGAGTTTGATTTGGAATACGTCAGAGTTGCTAAGATTTTGGGTGCCTCTATT
GATGACTCCTACGTCCAATAAGGTTTGATCATTACCAGAAGCTCTGAAGGCTCTATCACA
AGAGTTACTAACCCCAAGGTTGCTGTTTACTCTTGCCCTCTCGATACCCAACAAGCTGAA
ACTAAGGGAACTGTTTTAATTCAAAATGCTGAACAACTCCTTAATTACACTAAATCTGAA
GTAAATTATAAAAACTTAACTTTTTTGTTTATATATAAACCTTTATTAAAAATAGGAATC
CCACGCTGAATCCATTGTCAAGAAAATTGCTGATTCTGGTGTTAATTTTATCATTGCTGG
TGGTTCCATCTCTGAAATCGTTTTACATTACGTCGAAAAATATAAAATGATGATTGTTAA
GTGCACTTCCAAGTTCGAATTAAAGAGAATTTGCAAGGCTTTGGGTGCTTCTCCTGTTGC
TAGATTAGATGCTCCTAATCCTGAAGAAATTGGTTTCTGCGACTCTGCCTCAGTTGAAGA
AATCGGTTCTCAAAAGGTCACCATTATTAAGAAGGAAAGCTCCGACTGCAAATTAAATAC
TATTGTTTTGAGAGGTTCTACCCTTAACCTTTTGGACGATATTGAACGTGCTATTGACGA
TGGTGTCAATGTTTACAGATGTCTCCTCAAGGACGGCAAGTTTGGTAATTTGACTTATTA
CATCTCTTTAAACGATAAATTAATTAATTATTTTTAATAAATTTAGTCCCTGGTGCTGGT
GCCACTGAAGCCATCTTATCATACAAGTTATAATCTGAAGCTAAGAGCTTAGAAGATCTC
TCCCAATATGCTTTCAACAGATTTGCTTTATCTTTTGAAATTATCCCCAGAATTTTGTCT
GATAATGCAGGTTTGAACTCTAACGAAATCATCCCCAAGCTCAACACTGCCAATAAGGAA
GAACCCCACGGTATTGATATTGATGTAAGAATAAATAAAAAATTAAAACCCAGCATAAAT
TTAATTCTTGATATTTTATTTAAAAAAGAATGGCTCTATTAAGAAATCCTCTGAATTAGC
TGTCTATGACCACTTACAATCTAAGTTATGGGCTATTAGATTAGCTGCTGATGCTGCCAT
TACTATCCTTAAGGTTGATTAGGTAAACCCATTTAAATAATATTAATCACTACAAAAATA
AATGAATTTGATTGAAAATATGCTTACTTATTTTTGTTATTTTATAATAGATCGTAATTG
CTAAGCAAGCTGGTGGTCCTAAGATGAACCAATAATAGGGTCACTGGGACGACTAAGAAT
GAGGAATTTGAGTAGTTTCAAAAATTAAATAGTAATAATCACAATAACAACAATAACAAC
TTTAATTCAATAACATAAATTTAATAACCAAATTATTTTATTTTTCATTAAAAATATAAT
ATAACATAAATTTTGTAAGCAGATATGCGACTTACAATTCTCAAATCAAATCACACTATC
TATATCCTTCATTCATTTTTAACTTACAAAAATTAACTTAATTTAAATATAGTTAGTTTT
GATTTTAGTTGTTTTTAATTATATATTCTATTTCAGTTTGAAAAATACTCTTATTCAGTT
CTAAATAAATTCCATAAAATTCTGTTTGTTTAATTATTCATTTATTTTTATTAAATTGTC
TTTATTTTATTTTAATAAATAATTTCGTAGAACATTTTTTTTTTCCATACTTTATTTTCG
AAATATAAAAGATGAATTTAATTGTTTGTTTTCATTTTTGATATATTTTATATTGCTATG
TAAATCTTTAATGATTATAAATATTTATTTATTTATAATTTTAGATTTAAAAAACACTAA
ATTAACTAAATTTAATTTTTATAAATTAAATAATTTTTTTATATTCTTCTCAAAAAAAAA
TAAAAATAAAGAAGATCATTTATTAAATAATTTTTTTTTAAAAATGTTTAAAATTGAGAA
TTAAATTAATTTTACTTTCAAATATGAAAATTTAAAAATATGTAAAATTTAATGGTAAAT
CAACTAATAAATTAGCATTTATAATACAATTTTAATTTAATAATATCAATTATCAAAAAA
ATAATCTTATTTTTTAAGGTCTATAATAAAATACATTTTTACTAAATAAGCGAAATTAAA
AAGCTAAATATTTGAAATAAATTAATTTATTAAAAATAATTATAAAAATTGA