Identifiers and Description

Gene Model Identifier

TTHERM_00497960

Standard Name

CCT7 (Chaperonin Containing TCP-1 )

Aliases

PreTt06961 | 62.m00245 | TtCCTeta | 3715.m00106

Description

CCT-eta chaperonin subunit; expressed during cilia biogenesis and conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR02348 ) chaperonin GroL
  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02339 ) thermosome, various subunits, archaeal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00497960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_63840
WormBaseWBGene000203919.997093137033517e-262locus:cct-7 status:Confirmed
UniProt:Q9TZS5 protein_id
:CCD74224.1
Tetrahymena borealisEI9_20972.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (562 aa)
DictyBaseDDB_G02912259.997093137033517e-262cct7 on chromosome: 6 position
201367 to 203505
OxytrichaContig22245.0.g379.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYJL111W9.997093137033517e-262CCT7 Subunit of the cytosolic
chaperonin Cct ring complex, r
elated to Tcp1p, required for
the assembly of actin and tubu
lins in vivo; mutant has incre
ased aneuploidy tolerance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14567989: Seixas C, Casalou C, Melo LV, Nolasco S, Brogueira P, Soares H (2003) Subunits of the chaperonin CCT are associated with Tetrahymena microtubule structures and are involved in cilia biogenesis. Experimental cell research 290(2):303-21
  2. Ref:11718895: Casalou C, Cyrne L, Rosa MR, Soares H (2001) Microtubule cytoskeleton perturbation induced by taxol and colchicine affects chaperonin containing TCP-1 (CCT) subunit gene expression in Tetrahymena cells. Biochimica et biophysica acta 1522(1):9-21
  3. Ref:10524223: Domingues C, Soares H, Rodrigues-Pousada C, Cyrne L (1999) Structure of Tetrahymena CCT theta gene and its expression under colchicine treatment. Biochimica et biophysica acta 1446(3):443-9
  4. Ref:9819444: Won KA, Schumacher RJ, Farr GW, Horwich AL, Reed SI (1998) Maturation of human cyclin E requires the function of eukaryotic chaperonin CCT. Molecular and cellular biology 18(12):7584-9
  5. Ref:9337846: Soares H, Cyrne L, Casalou C, Ehmann B, Rodrigues-Pousada C (1997) The third member of the Tetrahymena CCT subunit gene family, TpCCT alpha, encodes a component of the hetero-oligomeric chaperonin complex. The Biochemical journal 326 ( Pt 1)( ):21-9
  6. Ref:8925913: Cyrne L, Guerreiro P, Cardoso AC, Rodrigues-Pousada C, Soares H (1996) The Tetrahymena chaperonin subunit CCT eta gene is coexpressed with CCT gamma gene during cilia biogenesis and cell sexual reproduction. FEBS letters 383(3):277-83
  7. Ref:8573069: Walkley NA, Demaine AG, Malik AN (1996) Cloning, structure and mRNA expression of human Cctg, which encodes the chaperonin subunit CCT gamma. The Biochemical journal 313 ( Pt 2)( ):381-9
  8. Ref:7961900: Soares H, Penque D, Mouta C, Rodrigues-Pousada C (1994) A Tetrahymena orthologue of the mouse chaperonin subunit CCT gamma and its coexpression with tubulin during cilia recovery. The Journal of biological chemistry 269(46):29299-307

Sequences

>TTHERM_00497960(coding)
ATGAGTTATCTTTTGCAACCTACCATTTTGCTCTTGAAGGACGGTACTGATACTTCCTAA
GGAAAGGCTTAAATTGTTTCCAACATTAATGCTGTCTAATCTATTGTAGAAATCGTTAAG
ACCACTTTAGGTCCCCGTGGTATGGATAAATTGATTGAAGGTGGAATGAAGGGAGCCACT
ATTTCCAATGATGGTGCTACTATTTTAAACTTATTAGATATTGTTCACCCTGCTGCTAAG
ACTCTTGTTGATATTGCTAAGGCTTAAGACGATGAAGTTGGTGATGGTACCACTTCTGTC
TGCCTTTTGGCTGGTGAATTATTGAAGGAATCTAAGTACTTCATCGAAGAAGGTATGCAC
CCATAAATTATCACTAAGGGTTACAAGGAAGCCCTCAAGTTAGCTCTTTAATTCTTACAC
GAAAATGCTCACTCTGTAGCTGATAAGAACGAAACTGAAAAGAGAGAAATGCTCATTAAG
TGCGCTTAAACCTCTTTAAACTCCAAATTATTAGCTCATTACAAGGAATTCTTCTCTGAG
TTAGTTGTTTAAGCCGTTGAAACTCTTGAAACTAATCTCCTCGACAAAGACCTTATCGGT
ATCAAGATGGTCACCGGTGGTTCAGTCACTGATTCTTTCTTGGTTAGTGGTGTCGCTTTC
AAGAAAACCTTCTCTTATGCAGGTTTTGAACAACAACCCAAAAAGTTCAATAACCCTAAG
ATTTGCTTACTTAACATCGAATTAGAATTAAAGGCTGAAAAGGAAAATGCTGAAATTAGA
ATTGAAAATCCTGATGATTACAAGTCAATTGTTGATGCTGAATGGGAGTTGATTTATGAA
AAGTTAAGAAAGATTGTTGAATCTGGTGCTAACATTGTTCTCTCCAAGCTTCCTATTGGT
GATTTGGCCACTCAATACTTCGCTGATCGTAACATTTTCTGTGCTGGTCGTGTTGATGCT
GAAGATATGAAGAGAGTCCAAAAATCTACTGGTGCCATCGTTCAAACCACTGTCAATGGT
TTGACTGAAGATGTCTTAGGTACTTGCAACCAATTCGAAGAAGTTTAAATCGGTGCTGAA
AGATATAACCTCTTCAAGGATTGCCCTCACTCTAAGAGTGCTACCATCATTTTAAGAGGT
GGTGCTGAATAATTCATTGCTGAAGCTGAACGTTCTCTTAATGATGCAATCATGATCGTC
AGAAGATGCATGAAGGCCAATAAAATCGTTCCTGGTGGTGGTGCCATCGAATTAGAAATC
TCTCGTCTTCTCCGTTTACACTCCAGAAAGACTGAAGGAAAGATCTAATTAGTTATTAAT
GCTTTTGCTAAGGCTCTTGAAGTCATTCCCAGAACTATTGCTGATAATGCTGGTCACGAC
TCCATTCAAGTTCTTAATAAACTCCGTCAAAAGCATGCTATTGAAACCGAACAATCTAGA
AACTTCGGTGTTGATATTAATGCTGCTGATGGTATTGGCAATAACTACGAAAATTTTGTT
TGGGAACCTATCGTTGTCAGAAAAAATGCTTTGTCTGCTGCCACTGAAGCTGCTTGCACT
ATTTTAAGTATTGATGAAACTGTTAGAAATCCCAAGAGTGAACAACCTAAGGCTCCCCCT
GGTGGACTCAGAAGAGGTGGTCCTCAAGGAATGGCTGGTTTGGCTAAAAATGCTAAGCTC
GGAAAGTGA


>TTHERM_00497960(protein)
MSYLLQPTILLLKDGTDTSQGKAQIVSNINAVQSIVEIVKTTLGPRGMDKLIEGGMKGAT
ISNDGATILNLLDIVHPAAKTLVDIAKAQDDEVGDGTTSVCLLAGELLKESKYFIEEGMH
PQIITKGYKEALKLALQFLHENAHSVADKNETEKREMLIKCAQTSLNSKLLAHYKEFFSE
LVVQAVETLETNLLDKDLIGIKMVTGGSVTDSFLVSGVAFKKTFSYAGFEQQPKKFNNPK
ICLLNIELELKAEKENAEIRIENPDDYKSIVDAEWELIYEKLRKIVESGANIVLSKLPIG
DLATQYFADRNIFCAGRVDAEDMKRVQKSTGAIVQTTVNGLTEDVLGTCNQFEEVQIGAE
RYNLFKDCPHSKSATIILRGGAEQFIAEAERSLNDAIMIVRRCMKANKIVPGGGAIELEI
SRLLRLHSRKTEGKIQLVINAFAKALEVIPRTIADNAGHDSIQVLNKLRQKHAIETEQSR
NFGVDINAADGIGNNYENFVWEPIVVRKNALSAATEAACTILSIDETVRNPKSEQPKAPP
GGLRRGGPQGMAGLAKNAKLGK


>TTHERM_00497960(gene)
ATATAAAATATACATAAAAAAAATCTTTAAAAAAATCAAAAACAAAAAGCACTCAAAATT
ATACAACCACATAATAAAGCTATGAGTTATCTTTTGGTATTTATTTTTTCTTTTTACTTA
ATTCTTAACAGCAGAAATATTTTACTACAAACCAATGCGCTTACTTTTGTCCAATATTTT
GCCTTAGTTAATTTGAAATCCCATAAAATGCTTCTCCTTGCGCCCATAAACAGCAAATTT
TACATGACCTTCAAATAGATTATTATTATTATTACCATTTAATACATTCGATTATAAGAT
TGTATTAACATATAGACTGTTTATGGCACTTATAGTAGCAAATAGTTTAAATATTGAAGC
TTATATCATGATGATTTCATATGATTTATTTGCTATTATCTGCACAAATAATGCTTTGCT
TTGATTTTAATTAACACTTTTTAACTTTTATACTATAGCAACCTACCATTTTGCTCTTGA
AGGACGGTACTGATACTTCCTAAGGAAAGGCTTAAATTGTTTCCAACATTAATGCTGTCT
AATCTATTGTAGAAATCGTTAAGACCACTTTAGGTAAATAAATTTAGAATTTTAAAAAAC
AATTTATACAAAAGCTTAGCAAATCTCAGCAATATAATCTTATTCAAGCAACTTATGAAA
AAGGATATAAAAAAAGCAATTGTTTGCTTAAATTGTTATTGTTATTAAGCAATATTCAAA
TAGGATACTTAAACCTAAATAAAATTTTTTTATTTTAAAGAAATAGAAATGTTATAAAGC
AATTTTACTTTAATTTTAAAATGTTTGAATAAAATTTGAAAAATAAACGATCAACCCACC
AAGCATCGAACAAAATATATCTTCTTCATTGATTATAAACAAAAGCACATAAAATAAAGA
TTATTAGATTTGTTAAATTTCATTCGACTCAAATTATATTCTAACCATCATTTTAATTTT
TATAGGTCCCCGTGGTATGGATAAATTGATTGAAGGTGGAATGAAGGGAGCCACTATTTC
CAATGATGGTGCTACTATTTTAAACTTATTAGATATTGTTCACCCTGCTGCTAAGACTCT
TGTTGATATTGCTAAGGCTTAAGACGATGAAGTTGGTGATGGTACCACTTCTGTCTGCCT
TTTGGCTGGTGAATTATTGAAGGAATCTAAGTACTTCATCGAAGAAGGTATGCACCCATA
AATTATCACTAAGGGTTACAAGGAAGCCCTCAAGTTAGCTCTTTAATTCTTACACGAAAA
TGCTCACTCTGTAGCTGATAAGAACGAAACGTAATTATTTATAAAGATATACTGTTATAT
AATCTAAATTATTATAATTTTACATTAGTGAAAAGAGAGAAATGCTCATTAAGTGCGCTT
AAACCTCTTTAAACTCCAAATTATTAGCTCATTACAAGGAATTCTTCTCTGAGTTAGTTG
TTTAAGCCGTTGAAACTCTTGAAACTAATCTCCTCGACAAAGACCTTATCGGTATCAAGA
TGGTCACCGGTGGTTCAGTCACTGTAAGATTTTATTTTTTAAAATTCAAAATATTCAAAA
AGGAAATTATCTAAATATGTGCCCAGCTAGCTAGCTAGCTACCTAAATTATTAACATTTT
TTAAAATTTTATTTTCATTAATAAATAGGATTCTTTCTTGGTTAGTGGTGTCGCTTTCAA
GAAAACCTTCTCTTATGCAGGTTTTGAACAACAACCCAAAAAGTTCAATAACCCTAAGAT
TTGCTTACTTAACATCGAATTAGAATTAAAGGCTGAAAAGGAAAATGCTGAAATTAGAAT
TGAAAATCCTGATGATTACAAGTCAATTGTTGATGCTGAATGGGAGTTGATTTATGAAAA
GTTAAGAAAGATTGTTGAATCTGGTGCTAACATTGTTCTCTCCAAGCTTCCTATTGGTGA
TTTGGCCACTCAATACTTCGCTGATCGTAACATTTTCTGTGCTGGTCGTGTTGATGCTGA
AGATATGAAGAGAGTCCAAAAATCTACTGGTGCCATCGTTCAAACCACTGTCAATGGTTT
GACTGAAGATGTCTTAGGTACTTGCAACCAATTCGAAGAAGTTTAAATCGGTGCTGAAAG
ATATAACCTCTTCAAGGATTGCCCTCACTCTAAGAGTGCTACCATCATTTTAAGAGGTGG
TGCTGAATAATTCATTGCTGAAGCTGAACGTTCTCTTAATGATGCAATCATGATCGTCAG
AAGATGCATGAAGGCCAATAAAATCGTTCCTGGTGGTGGTGCCATCGAATTAGAAATCTC
TCGTCTTCTCCGTTTACACTCCAGAAAGACTGAAGGAAAGATCTAATTAGTTATTAATGC
TTTTGCTAAGGCTCTTGAAGTCATTCCCAGAACTATTGCTGATAATGCTGGTCACGACTC
CATTCAAGTTCTTAATAAACTCCGTCAAAAGCATGCTATTGAAACCGAACAATCTAGAAA
CTTCGGTGTTGATATTAATGCTGCTGATGGTATTGGCAATAACTACGAAAATTTTGTTTG
GGAACCTATCGTTGTCAGAAAAAATGCTTTGTCTGCTGCCACTGAAGTAAACATTTATTT
ACAAAGTTCAATCATATTTATTAAATTTATAATTTTACAAATTAGGCTGCTTGCACTATT
TTAAGTATTGATGAAACTGTTAGAAATCCCAAGAGTGAACAACCTAAGGCTCCCCCTGGT
GGACTCAGAAGAGGTGGTCCTCAAGGAATGGCTGGTTTGGCTAAAAATGCTAAGCTCGGA
AAGTGAGTTTTAAATAATTAAGCAAAGAAACAATAAAATTAAATCAATATTATTCTTAAT
TATCATTTATAATGTAATTATAGGTCATTTTTTGTATATTTATTTTTATTAAGTGTTTTA
AATAAATTAGAAAAAATGACTAATTCAAAATACTTTCA