Identifiers and Description

Gene Model Identifier

TTHERM_00670500

Standard Name

CCT6 (CCT6 Ortholog)

Aliases

PreTt01074 | 100.m00135 | 3731.m00045

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02348 ) chaperonin GroL
  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02339 ) thermosome, various subunits, archaeal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00670500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_166000
WormBaseWBGene000003819.997093137033517e-262locus:cct-6 T-complex protei
n 1 subunit zeta status:Conf
irmed UniProt:P46550 prote
in_id:CCD65990.1
Tetrahymena borealisEI9_16462.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (536 aa)
DictyBaseDDB_G02774939.997093137033517e-262cct6 on chromosome: 2 position
8001157 to 8003005
OxytrichaContig1206.0.g429.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYDR188W9.997093137033517e-262CCT6 Subunit of the cytosolic
chaperonin Cct ring complex, r
elated to Tcp1p, essential pro
tein that is required for the
assembly of actin and tubulins
in vivo; contains an ATP-bind
ing motif

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670500(coding)
ATGTCTAACGTTCAATATGTCAATTCTAAGGCTGAAGTCTTAAAGAAGTTCTAGGCTCTT
GCCATGAATATCCATGCCGCTGTCGGCTTACAAGAAGTCATGAGATCTAACCTTGGTCCT
AAGGGTACTCTCAAGATGCTTGTTGGTGGTGCTGGTTAAATCAAGCTTACCAAGGACGGT
TCAGTCTTATTACATGAAATGTAAATTCAACACCCCACTGCTGCCATGATTGCTCGTTCT
GCCACTGCTCAAGATGATATTGTCGGTGATGGTACCACCTCTAACGTCCTCTTCATTGGT
GAAATGATGAAATAAGCTCAAAGATTAATTCAAGATGGTATCCACCCCAGAACTATTACT
GATGGTTACGAAGCTGCCAAGCACGAATCTCTTAAGTTCTTAGACGAATTCAAGTAAAAC
CTCACTGAATCATAAATCGACAAGGCTTTCCTTCTTTCTGTCGCTAGAACTTCTTTGAAC
ACTAAGCTCCACCCTGATATTGCTAACTAATTGGTTGAAATAGTCGTTGACTCCGTTCTT
TGCATCAAGCAATAAGATAAACCTATTGATTTACATATGGTTGAAATTATGCACATGGTT
CACAAGCTCTCTACTGATACTAGATTAGTTAAGGGTTTAGTTTTAGATCATGGTGCTCGT
CATGCTGATATGCCCAAGAAACTTAAGAACTGTTACATTCTTAATTGCAACGTTTCTTTA
GAATACGAAAAGACTGAAGTCCACTCTGGTTTCTTCTATTCCAACGCTGCTGACAGAGAA
AAGTTGATGCTTTCTGAACGTAAATTCACTGATGAAAGATGCCAAAAGATTATTGACCTC
AAGAGAAAGGTTTGCGAAGACCCCTCTAAGTCCTTTGTTGTTCTCAACTAAAAGGGTATT
GACCCCATTTGCCTTGATATGTTTGCTAAGGAAAATATCATCGCTTTGAGAAGAACAAAG
AGAAGAAACATGGAAAGAATCATTCTTGCTTGTGGTGGTAACGGTGTTAACTCCGTTGAA
GATTTATCTGAAGCTGATCTTGGTTGGGCTGATGAAGTTTATGAACACACTTTGGGTGAA
GAAAAGTACACTTTCATTGAAGGTGTCAAGAATCCCAAGTCATGCACCATTCTTATCAAG
GGACCTAACGAGCACACTATTGCTCAAATTAAGGAAGCTATCAGAGATGGTTTAAGAGCT
GTTAAAAACGTTTTTGATGACAAGTGCGTTATCCCTGGTGCTGGTGCTTTTGAAATTGGT
GCTTACTGCCATTTACAAAAGTTCAAGGATTCCGTTAAGGGTAAGGCTAAATTAGGTGTT
GAAGCCTTTGCTGAATCTTTACTCATCATCCCCAAGATTTTAGCTGAAAACTGCGGTTAT
GATGTTTAAGATACAATCCTTGAAGTTATCGATGAATATAAAGCCAAGTAAGTTCCTGTT
GGTATCAACTGCAACGAAAAGGGTACTATTTCTCCTGTTGCTTCTGCTATTTATGATAAC
TATATTGCCAAGAAGCAATTCTTACATATGGCTCCTACTCTTGCCCAATAACTCCTTCTT
GTTGACGAAATCATGAGAGCTGGTAAATAGATGGGTGGTGGTAATTGA


>TTHERM_00670500(protein)
MSNVQYVNSKAEVLKKFQALAMNIHAAVGLQEVMRSNLGPKGTLKMLVGGAGQIKLTKDG
SVLLHEMQIQHPTAAMIARSATAQDDIVGDGTTSNVLFIGEMMKQAQRLIQDGIHPRTIT
DGYEAAKHESLKFLDEFKQNLTESQIDKAFLLSVARTSLNTKLHPDIANQLVEIVVDSVL
CIKQQDKPIDLHMVEIMHMVHKLSTDTRLVKGLVLDHGARHADMPKKLKNCYILNCNVSL
EYEKTEVHSGFFYSNAADREKLMLSERKFTDERCQKIIDLKRKVCEDPSKSFVVLNQKGI
DPICLDMFAKENIIALRRTKRRNMERIILACGGNGVNSVEDLSEADLGWADEVYEHTLGE
EKYTFIEGVKNPKSCTILIKGPNEHTIAQIKEAIRDGLRAVKNVFDDKCVIPGAGAFEIG
AYCHLQKFKDSVKGKAKLGVEAFAESLLIIPKILAENCGYDVQDTILEVIDEYKAKQVPV
GINCNEKGTISPVASAIYDNYIAKKQFLHMAPTLAQQLLLVDEIMRAGKQMGGGN


>TTHERM_00670500(gene)
ATGTCTAACGTTCAATATGTCAATTCTAAGGCTGAAGTCTTAAAGAAGTTCTAGGCTCTT
GCCATGAATATCCATGCCGCTGTCGGCTTACAAGAAGTCATGAGATCTAACCTTGGTCCT
AAGGGTACTCTCAAGATGTAATTTATTTTGAATTTAACTCATAATCTCTACTAAATAACA
TATAGATCATCTCATTTTGAGCCCTATTTAAAATCATTTTTCCGCCTTAATATTTAGCAA
AGGAATTAACTTTTTACTTAAGTTTTTTGAGAAACATTAAGTGGTTGATATAAAAATATT
AAGACTTTTATTAACTTTGATAGAGCTACACTTTTATTATTTTAAACTATGAATTATTCT
AATCGCAATTTTAATAATATTTAGGCTTGTTGGTGGTGCTGGTTAAATCAAGCTTACCAA
GGACGGTTCAGTCTTATTACATGAAATGGTAATATTTTATTGGTTTAATTGACTTAATAT
TATTATTCATTTAAATAAACAACAAAAAAGTAGAATTTAAATATTAATCAAGTTCAATCA
ATTTATAATTATAAGCATTAATTTGTCATTAAATAAAACATGGCTTTGAATCTTTATATG
AAAAATTGCATTTGTGTCTTTAATTTAAAAAAAATTTATTTAATAATTCATATTTTAATT
TAAATTAGTAAATTCAACACCCCACTGCTGCCATGATTGCTCGTTCTGCCACTGCTCAAG
ATGATATTGTCGGTGATGGTACCACCTCTAACGTCCTCTTCATTGGTGAAATGATGAAAT
AAGCTCAAAGATTAATTCAAGATGGTATCCACCCCAGAACTATTACTGATGGTTACGAAG
CTGCCAAGCACGAATCTCTTAAGTTCTTAGACGAATTCAAGTAAAACCTCACTGAATCAT
AAATCGACAAGGCTTTCCTTCTTTCTGTCGCTAGAACTTCTTTGAACACTAAGCTCCACC
CTGATATTGCTAACTAGTATGCCAAATTTTATTTTATATTTTTTTTTAAAAAGAATCAAG
CTAGAAACCAAAAAGAATGAAAATTAAGCATATATTAAGAATAATAATTTTATTTCAGAA
ACTAATTTTATTTTTTAATAATGTAGATTGGTTGAAATAGTCGTTGACTCCGTTCTTTGC
ATCAAGCAATAAGATAAACCTATTGATTTACATATGGTTGAAATTATGCACATGGTTCAC
AAGCTCTCTACTGATACTAGATTAGTTAAGGGTTTAGTTTTAGATCATGGTGCTCGTCAT
GCTGATATGCCCAAGAAACTTAAGAACTGTTACATTCTTAATTGCAACGTTTCTTTAGAA
TACGAAAAGACTGAAGTCCACTCTGGTTTCTTCTATTCCAACGCTGCTGACAGAGAAAAG
TTGATGCTTTCTGAACGTAAATTCACTGATGAAAGATGCCAAAAGATTATTGACCTCAAG
AGAAAGGTTTGCGAAGACCCCTCTAAGTCCTTTGTTGTTCTCAACTAAAAGGGTATTGAC
CCCATTTGCCTTGATATGTTTGCTAAGGAAAATATCATCGCTTTGAGAAGAACAAAGAGA
AGAAACATGGAAAGAATCATTCTTGCTTGTGGTGGTAACGGTGTTAACTCCGTTGAAGAT
TTATCTGAAGCTGATCTTGGTTGGGCTGATGAAGTTTATGAACACACTTTGGGTGAAGAA
AAGTACACTTTCATTGAAGGTGTCAAGAATCCCAAGTCATGCACCATTCTTATCAAGGGA
CCTAACGAGCACACTATTGCTCAAATTAAGGTAATTAATCATATAAATTATTTTAATACA
TGTTTTTAAATTATTATTTTTATTAAATTATAGGAAGCTATCAGAGATGGTTTAAGAGCT
GTTAAAAACGTTTTTGATGACAAGTGCGTTATCCCTGGTGCTGGTGCTTTTGAAATTGGT
GCTTACTGCCATTTACAAAAGTTCAAGGATTCCGTTAAGGGTAAGGCTAAATTAGGTGTT
GAAGCCTTTGCTGAATCTTTACTCATCATCCCCAAGATTTTAGCTGAAAACTGCGGTTAT
GATGTTTAAGATACAATCCTTGAAGTTATCGATGAATATAAAGCCAAGTAAGTTCCTGTT
GGTATCAACTGCAACGAAAAGGGTACTATTTCTCCTGTTGCTTCTGCTATTTATGATAAC
TATATTGCCAAGAAGCAATTCTTACATATGGCTCCTACTCTTGCCCAATAACTCCTTCTT
GTTGACGAAGTAAATATATTAAATTAAATAAATTTTTAACATGATTTAATAAAAAATTTT
ATAAAAAATAGATCATGAGAGCTGGTAAATAGATGGGTGGTGGTAATTGA