Identifiers and Description

Gene Model Identifier

TTHERM_00134970

Standard Name

CCT5 (CCT5 Ortholog)

Aliases

PreTt24321 | 10.m00370 | 3698.m00091

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02348 ) chaperonin GroL
  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR00225 ) C-terminal processing peptidase
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02339 ) thermosome, various subunits, archaeal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00134970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_376760
WormBaseWBGene000003809.997093137033517e-262locus:cct-5 T-complex protei
n 1 subunit epsilon status:C
onfirmed UniProt:P47209 pr
otein_id:CAA83681.1
Tetrahymena borealisEI9_40914.19.997093137033517e-262CCTepsilon subunit (377 aa)
DictyBaseDDB_G02818499.997093137033517e-262cct5 on chromosome: 3 position
5012149 to 5014049
OxytrichaContig18220.0.g179.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYJR064W9.997093137033517e-262CCT5 Subunit of the cytosolic
chaperonin Cct ring complex, r
elated to Tcp1p, required for
the assembly of actin and tubu
lins in vivo

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00134970(coding)
ATGTCTTTAGCTTTTGACGAATACGGACGCCCCTTCATCATTATCAGAGAATAAGACTAA
AAGAAACGTCTTAAAGGTATCGATGCATACAAAGCTAACATCTAAGCTGCCAAGACTATT
GCTAGCACTTTAAGATCATCCTTGGGTCCTAAGGGTATGGATAAGATGATGATCTCTCCT
GATGGAGATGTCAGTGTTACCAATGATGGTGCTACCATTGTTGAAAAGATGGACATTTAA
CATCCTGTTGCAAAATTGATGGTTGAACTCAGTCAATCTTAAGATAATGAAATTGGTGAT
GGTACCACTGGTGTTGTTGTTTTAGCTGGTGCATTGTTGGAACAAGCCAACATCCTCATC
GATAAGGGTCTTCACCCTCTTAAGATTGCTGACGGTTTCGACAAGGCTTGTGAAATCGCT
TGCGAAAGACTTGAATAAATTGCTGAAGACATTGACATCAACGAAAATACCCACGAAAGA
TTAGTCGAAGCTGCCATGACTGCTTTGAGCTCTAAGGTCGTTAGTAAAAATAAAAGAAAG
ATGGCTTAAATCTCCGTTGATGCCGTCCTTTCCGTTGCTGATCTTGAAAGAAGAGATGTC
AACTTTGACTTGATTAAGCTCCAAGAAAAGACTGGAGGTTCCTTAGAAGATACTAGACTC
ATCCAAGGTATTTTAGTTGAAAAGGATATGTCTCATCCTTAAATGCCCAAGGAAATTTAG
GATGCTAAGATTGCCATCTTAACCTGCCCCTTCGAACCCCCTAAACCCAAAACCAAGCAT
AACATTAACATTACTAACGCTGAAGATTACAAGAAATTATACGCCTAAGAATAATAATAT
TTCAAGGATATGGTTGCTGACTGCAAAAAGTCTGGTGCCAACCTTATTATGTGCCAATGG
GGTTTCGATGATGAAGCTAATCATTTATTATTATAAGCTGATTTACCCGCTGTTAGATGG
GTTAGCGGTACTGATATTGAATTGATTGCTGTCGCCACTGGTGGTAGAATCGTACCAAGA
TTCGAAGAGCTCTCTGCTGATAAGTTAGGTGAAGCTAAGGTCGTTAGAGAAATTTAATTC
GGTACTTCCAATGAAAGAATGCTCGTTATTGAAGAATGCAAGCAATCTAAGGCTGTTACT
ATTTTGATTAGAGGTGGTTCTAACATGATTGTCTCTGAAGCCAAAAGAAGTATTCACGAT
GCTAACTGTGTTGTTAGAAACTTAATCAAGTGCCCTAAGGTCGTTTATGGTGGTGGTTCT
GCTGAAATTGCTTGTGCTTTAACTGTTAACTAAGAAGCTGATAAGATTTCATCAGTTGAA
TAATACGCTGTTAGAGCTTTCGCTGATGCTTTGGAAGATATTCCCAACGCTTTAGCTGAT
AACTCTGGTTTAAATCCTATTGAAGCTGTTGCTAATGCTAAGGCCTTATAGGTTAGTCAA
AACAATCCTAGAATTGGTGTTGACTGCTTACTTGAAGGTACATCTGATATGAAAGAATAG
AAGGTATATGAAACTTACTTATCCAAGAGATAATAATTCTAATTAGCTACTTAAGTTGTT
AAGATGATCTTAAAGATTGATGATGTTATTTCTCCTGATCACTAATGA


>TTHERM_00134970(protein)
MSLAFDEYGRPFIIIREQDQKKRLKGIDAYKANIQAAKTIASTLRSSLGPKGMDKMMISP
DGDVSVTNDGATIVEKMDIQHPVAKLMVELSQSQDNEIGDGTTGVVVLAGALLEQANILI
DKGLHPLKIADGFDKACEIACERLEQIAEDIDINENTHERLVEAAMTALSSKVVSKNKRK
MAQISVDAVLSVADLERRDVNFDLIKLQEKTGGSLEDTRLIQGILVEKDMSHPQMPKEIQ
DAKIAILTCPFEPPKPKTKHNINITNAEDYKKLYAQEQQYFKDMVADCKKSGANLIMCQW
GFDDEANHLLLQADLPAVRWVSGTDIELIAVATGGRIVPRFEELSADKLGEAKVVREIQF
GTSNERMLVIEECKQSKAVTILIRGGSNMIVSEAKRSIHDANCVVRNLIKCPKVVYGGGS
AEIACALTVNQEADKISSVEQYAVRAFADALEDIPNALADNSGLNPIEAVANAKALQVSQ
NNPRIGVDCLLEGTSDMKEQKVYETYLSKRQQFQLATQVVKMILKIDDVISPDHQ


>TTHERM_00134970(gene)
ATGTCTTTAGCTTTTGACGAATACGGACGCCCCTTCATCATTATCAGAGAATAAGACTAA
AAGAAACGTCTTAAAGGTATCGATGCATACAAAGTAAAAATTATTTACATTCTTTTGCAT
AGTTGGAAAAGCTTAGCAGCGTCTGTCCATTTTGCAGAAAATTATTTCATAAATGCAATT
AGTAGAATGTATGTATTTATTTACACACAAACTATTGACTCAATATGAATTGCTTTTTCT
CAACCATAAAAATTTAACTCATAAACAATAAACTATTATGATAGATTACTGATAAATAGA
ATTTAATAAATATGGCTCAATAATTTACCTTGATTTCAATAAAAAGTGAATTAGTAGAAT
CGCACAAGCAACATTTTTAGATAATAGAATTTAATCAAATTAGAGTTTCAAATGCATTAA
AAATTTAACTCTTCTCATAGCAAATAAACATTTATGTCAAAAAAAATGAGATTTTTATTT
TGAAAAGCTTTTCTAATTAATTTATTCTTATGAAATTTAAAATTTTTTAAACTCAATCTT
TATTTAACTTTATAGGCTAACATCTAAGCTGCCAAGACTATTGCTAGCACTTTAAGATCA
TCCTTGGGTCCTAAGGGTATGGATAAGATGATGATCTCTCCTGATGGAGATGTCAGTGTT
ACCAATGATGGTGCTACCATTGTTGAAAAGATGGACATTTAACATCCTGTTGCAAAATTG
ATGGTTGAACTCAGTCAATCTTAAGATAATGAAATTGGTGATGGTACCACTGGTGTTGTT
GTTTTAGCTGGTGCATTGTTGGAACAAGCCAACATCCTCATCGATAAGGGTCTTCACCCT
CTTAAGATTGCTGACGGTTTCGACAAGGCTTGTGAAATCGCTTGCGAAAGACTTGAATAA
ATTGCTGAAGACATTGACATCAACGAAAATACCCACGAAAGGTAAATATTAAAGAATATT
CAGTCATTTGTTAGGAATAAAAAAGATATAATAACAATTTAAATAAATCATATTTAAAGT
ATTTATCAACTTACAAGTAAATTGAAAAATAAATTTATTCAAAAAATAGATTAGTCGAAG
CTGCCATGACTGCTTTGAGCTCTAAGGTCGTTAGTAAAAATAAAAGAAAGATGGCTTAAA
TCTCCGTTGATGCCGTCCTTTCCGTTGCTGATCTTGAAAGAAGAGATGTCAACTTTGACT
TGATTAAGCTCCAAGAAAAGACTGGAGGGTAATTAATTATTTATATACCATAAACTTACT
AAACTAAATATCACATATACAAATAGTTCCTTAGAAGATACTAGACTCATCCAAGGTATT
TTAGTTGAAAAGGATATGTCTCATCCTTAAATGCCCAAGGAAATTTAGGATGCTAAGATT
GCCATCTTAACCTGCCCCTTCGAACCCCCTAAACCCAAAACCAAGCATAACATTAACATT
ACTAACGCTGAAGATTACAAGAAATTATACGCCTAAGAATAATAATATTTCAAGGATATG
GTTGCTGACTGCAAAAAGTCTGGTGCCAACCTTATTATGTGCCAATGGGTAATTAATTAA
ACATATTTTTATTGCAAGAAATTAATTCTTACTAAATCAATAAATAAATAGGGTTTCGAT
GATGAAGCTAATCATTTATTATTATAAGCTGATTTACCCGCTGTTAGATGGGTTAGCGGT
ACTGATATTGAATTGATTGCTGTCGCCACTGGTGGTAGAATCGTACCAAGATTCGAAGAG
CTCTCTGCTGATAAGTTAGGTGAAGCTAAGGTCGTTAGAGAAATTTAATTCGGTACTTCC
AATGAAAGAATGCTCGTTATTGAAGAATGCAAGCAATCTAAGGCTGGTAAGGATATATTT
AGTAAAAGACAGTTTAATAATTAAATTTTATAATTATAGTTACTATTTTGATTAGAGGTG
GTTCTAACATGATTGTCTCTGAAGCCAAAAGAAGTATTCACGATGCTAACTGTGTTGTTA
GAAACTTAATCAAGTGCCCTAAGGTCGTTTATGGTGGTGGTTCTGCTGAAATTGCTTGTG
CTTTAACTGTTAACTAAGAAGCTGATAAGATTTCATCAGTTGAATAATACGCTGTTAGAG
CTTTCGCTGATGCTTTGGAAGATATTCCCAACGCTTTAGCTGATAACTCTGGTTTAAATC
CTATTGAAGCTGTTGCTAATGCTAAGGCCTTATAGGTTAGTCAAAACAATCCTAGAATTG
GTGTTGACTGCTTACTTGAAGTAATAATTTCATATTTTGACTATTTAAAGTCATAACATT
TTTTTAATTAATTAATTTTTAGGGTACATCTGATATGAAAGAATAGAAGGTATATGAAAC
TTACTTATCCAAGAGATAATAATTCTAATTAGCTACTTAAGTTGTTAAGATGATCTTAAA
GATTGATGATGTTATTTCTCCTGATCACTAATGA