Identifiers and Description

Gene Model Identifier

TTHERM_00037050

Standard Name

CCT4 (Chaperonin Containing TCP-1 ortholog 4)

Aliases

PreTt14440 | 2.m02151 | 3825.m02812

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00037050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_256880
WormBaseWBGene000003799.997093137033517e-262locus:cct-4 T-complex protei
n 1 subunit delta status:Con
firmed UniProt:P47208 prot
ein_id:CAA88861.1
Tetrahymena borealisEI9_00964.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (543 aa)
DictyBaseDDB_G02928729.997093137033517e-262cct4 on chromosome: 6 position
2188382 to 2190167
OxytrichaContig5123.0.g619.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYDL143W9.997093137033517e-262CCT4 Subunit of the cytosolic
chaperonin Cct ring complex, r
elated to Tcp1p, required for
the assembly of actin and tubu
lins in vivo

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037050(coding)
ATGAGCGAGGGAAGTAAAGCCGCTGCTGTTAAAGTAAGTACCAACAGCAAGTAGGGAGAT
ACCTAAAATAGATCTGAAAAGACCAATGACATCAGAACCACCAACATTCAAGCTGCTAAG
GCTGTTGCTGATGTTATTAGAACCAGTTTAGGTCCTAGAGGTATGGATAAGATGATCTAA
GATGCTAAGGGTCAAGTTCTCATTACCAATGATGGTGCAACTATTCTCAAGCAAATGGAT
GTCATTCATCCTACTGCTAAGATGCTTGTCGAAATTTCTAAGGCACAAGATATTGAAGCT
GGTGACGGTACCACTTCAGTTGTCGTTATTGCTGGTGCTCTCCTTCACGCCTGTGAAAGT
TTATTAGCTAGAGGTATTCACCCTACCACTATCTCTGAAGGTTTCTAAATTGCTTTAGAT
GAAGCCCTTAAGGTTCTTAAGGACATCTCCTAAACCGTTGACTTGAAGGACAGAGATGCT
CTTATTACTTGTGTTAACACTGCCTTATCCTCTAAGGTTATTTCAACTAACTCTTAATAA
TTATCTCCCATCGCTGTCGATGCTGTTCTTAAGATTATTGATCCCACCAAGGACACCAAT
GCTGATTTGAGAGATATTAAGGTTGTCAAGAAGTTAGGTGGTACCATTGAAGACACTGAA
TTGATTGAAGGTTTGGTCTTCACTAACTAAAAGCCCTCCTAATCTGCTGGTGGTCCCAGT
AGAATTAAAGACGCTAAGATTGCTTTGATCCAATTCTGCTTGAGCTCCCCCAAGACTGAT
GTTGAAAACTCCGTCGTTGTCAAGGATTACACTGCTATGGACAGAATCCTCAAGGAAGAA
AGAAAATATATTGCCAATCTCGTTTCCAAGATTGTCAAATCTGGTGCCAATGTTATCCTT
ATTTAAAAATCTATCCTCAGAGACGCCACTAACGAACTCTCTCTCCATTTCCTTGCCAAG
AAGGGTATTATGGTTGTTAAGGATATTGAAAGAGAAGATGTTGAATTTATCACCAAGACC
ATCGGAGCTATCCCTGTTGCTCACATTGATCACTTAACTCCTGAAAAGTTAGGTAAGGCT
GAACTCTGTGAAGATGTTAAGCTTTCTGATGACTCTAGAATCTTAAAAATTACTGGAGTC
CAATCTAAGGCTAAGACTGTTACCATTCTCTGCCGTGGTTCTAACTCTCTTGTTATTGAC
GAAGCTGAAAGATCTTTACATGATGCTTTGTGCGTTGTCCGTTCATTGGTTAAGAACAGA
GGTTTAGTTCCTGGTGGTGGTGTTCCTGAAGTTGAAATTTCTCAATAATTATCCAAATTA
TCTAGAGAAATGAAGGGTGTTAACTCTCTTATTGTTAGAGCTTTCGCTGATGCTTTAGAA
GTTATCCCCTACACTTTAGCTGAAAATGCTGGTTTGAACCCCATCAATATTGTAACTGAT
TTAAGAAATAGACACGCTCTCGGACATAAATACGCTGGTATCTCAATCAGAAAGGGTACT
ATAAATGATGATATCACCACCGAAAATGTTCTTCAACCCGCTCTCGTCACCCAATCTGCC
CTCACTCTTGCCACTGAATGTGTCAGAATGATTCTTAAAATTGATGATTTGGTCTTCTCT
GCTCGTTGA


>TTHERM_00037050(protein)
MSEGSKAAAVKVSTNSKQGDTQNRSEKTNDIRTTNIQAAKAVADVIRTSLGPRGMDKMIQ
DAKGQVLITNDGATILKQMDVIHPTAKMLVEISKAQDIEAGDGTTSVVVIAGALLHACES
LLARGIHPTTISEGFQIALDEALKVLKDISQTVDLKDRDALITCVNTALSSKVISTNSQQ
LSPIAVDAVLKIIDPTKDTNADLRDIKVVKKLGGTIEDTELIEGLVFTNQKPSQSAGGPS
RIKDAKIALIQFCLSSPKTDVENSVVVKDYTAMDRILKEERKYIANLVSKIVKSGANVIL
IQKSILRDATNELSLHFLAKKGIMVVKDIEREDVEFITKTIGAIPVAHIDHLTPEKLGKA
ELCEDVKLSDDSRILKITGVQSKAKTVTILCRGSNSLVIDEAERSLHDALCVVRSLVKNR
GLVPGGGVPEVEISQQLSKLSREMKGVNSLIVRAFADALEVIPYTLAENAGLNPINIVTD
LRNRHALGHKYAGISIRKGTINDDITTENVLQPALVTQSALTLATECVRMILKIDDLVFS
AR


>TTHERM_00037050(gene)
ATGAGCGAGGGAAGTAAAGCCGCTGCTGTTAAAGTAAGTACCAACAGCAAGTAGGGAGAT
ACCTAAAATAGATCTGAAAAGACCAATGACATCAGAACCACCAACATTCAAGCTGCTAAG
GGTATTTATTAATTTCTAATTCTACAATCTCTCTATATCACTAGACAAAAGACATACACA
CATACACACATACCTTCTTTATTGCATAATGCAAGCTAAAATATCTATTTAAAAACTTAA
ATCAGAGGGTTCCTGATTCATTTTATCAAAACAGTTTTCTTTAAGAGAAAGAAATCAATT
ATGCAGCAAGTTTTTTAAATTAAAATGAAACAATTAAAAGCGCTGTTGTTTATAGCACTT
AAAAATAAATCAAGGTATCTGTTTGTTTTAATATCATAGTGATTAGAATGAGAGTATAAA
GCTGCTTTGAAATATTTAAAAGCATCTTATTTTACAATTCAAATCTAATATCTTTTTCTA
TTAAATGAAAGCTGTTGCTGATGTTATTAGAACCAGTTTAGGTCCTAGAGGTATGGATAA
GATGATCTAAGATGCTAAGGTAAATAAATTAACATTCAATTAATTCATTATCAAAGTCAA
GAGAATGCATTTAACTTATATTCATCCAAATTTTGCATGAGCATGGCTAACTTAAGATTT
AATAGTATTTTGATAGAACATTAATCCAAACATGAATAAATTAGTGATTGAAAAAAACAA
ATATTTTTCAAACAAAGTCTGATTTTATTCATCAAAGCAATTTAAAAATTGTCTTTGAGA
TGCCTCTATTGTATTACTTTAATCGATAAGTTCTCTTGACAAAATCGTTTGTTAAATTAG
ACTGTTTTACTCATTTTTATTTAATTAATAATAGGGTCAAGTTCTCATTACCAATGATGG
TGCAACTATTCTCAAGCAAATGGATGTCATTCATCCTACTGCTAAGATGGTAAATAAATT
TATTTTTCTTTAACACTCTCTTCTTAAGTTTACAACAACAAAAAAGACTGACAATAAGCA
ATAAAAAAAGTCTAAATAAATAAACAAACAAGCAATTTATAGTAGAAATAGCAAACAATT
ATTCAATTCAATGTGCTTAAATACACCAAGAAGAATAGAAATAACTTGGGTCTATAAAAA
ATAACAAATAAAACTCATTTACTAAGAAGAAATAATATTGATTTAATAATGATGTTAACA
AATACTTTTTATTTATTATAAAGCTTGTCGAAATTTCTAAGGCACAAGATATTGAAGCTG
GTGACGGTACCACTTCAGTTGTCGTTATTGCTGGTGCTCTCCTTCACGCCTGTGAAAGTT
TATTAGCTAGAGGTATTCACCCTACCACTATCTCTGAAGGTTTCTAAATTGCTTTAGATG
AAGCCCTTAAGGTTCTTAAGGACATCTCCTAAACCGTTGACTTGAAGGACAGAGATGCTC
TTATTACTTGTGTTAACACTGCCTTATCCTCTAAGGTTATTTCAACTAACTCTTAATAAT
TATCTCCCATCGCTGTCGATGCTGTTCTTAAGATTATTGATCCCACCAAGGACACCAATG
CTGATTTGAGAGATATTAAGGTTGTCAAGAAGTTAGGTGGTACCATTGAAGACACTGAAT
TGATTGAAGGTTTGGTCTTCACTAACTAAAAGCCCTCCTAATCTGCTGGTGGTCCCAGTA
GAATTAAAGACGCTAAGATTGCTTTGATCCAATTCTGCTTGAGCTCCCCCAAGACTGATG
TTGAAAACTCCGTCGTTGTCAAGGATTACACTGCTATGGACAGAATCCTCAAGGAAGAAA
GAAAATATATTGCCAATCTCGTTTCCAAGATTGTCAAATCTGGTGCCAATGTTATCCTTA
TTTAAAAATCTATCCTCAGAGACGCCACTAACGAACTCTCTCTCCATTTCCTTGCCAAGA
AGGGTATTATGGTTGTTAAGGATATTGAAAGAGAAGATGTTGAATTTATCACCAAGGTAA
ATTATATTCATTTTTTATTTTCTTTTTTCTAAAAATTTTCTTTTATTAATTTAGACCATC
GGAGCTATCCCTGTTGCTCACATTGATCACTTAACTCCTGAAAAGTTAGGTAAGGCTGAA
CTCTGTGAAGATGTTAAGCTTTCTGATGACTCTAGAATCTTAAAAATTACTGGAGTCCAA
TCTAAGGCTAAGACTGTTACCATTCTCTGCCGTGGTTCTAACTCTCTTGTATATTTTTTA
TTATTGAACAAATGAAATCAATAATTTTTTGCCAAAAATACCTTTTTTTAAATGTTTTAT
TTTGTAAATAAATAGGTTATTGACGAAGCTGAAAGATCTTTACATGATGCTTTGTGCGTT
GTCCGTTCATTGGTTAAGAACAGAGGTTTAGTTCCTGGTGGTGGTGTTCCTGAAGTTGAA
ATTTCTCAATAATTATCCAAATTATCTAGAGAAATGAAGGGTGTTAACTCTCTTATTGTT
AGAGCTTTCGCTGATGCTTTAGAAGTTATCCCCTACACTTTAGCTGAAAATGCTGGTTTG
AACCCCATCAATATTGTAACTGATTTAAGAAATAGACACGCTCTCGGACATAAATACGCT
GGTATCTCAATCAGAAAGGGTACTATAAATGATGATATCACCACCGAAAATGTTCTTCAA
CCCGCTCTCGTCACCCAATCTGCCCTCACTCTTGCCACTGAATGTGTCAGAATGATTCTT
AAAATTGATGATTTGGTAAATAAATAATAATTCATTTAAAAAGCAAATTTACTTATATTT
AAATATAAAAATAGGTCTTCTCTGCTCGTTGA