Identifiers and Description

Gene Model Identifier

TTHERM_00149340

Standard Name

CCT2 (CCT2 Ortholog)

Aliases

PreTt20693 | 12.m00367 | 3700.m00089 | APF1

Description

TCP-1/cpn60 chaperonin family protein; involved in tertiary and quaternary structure stabilization

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02348 ) chaperonin GroL
  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02339 ) thermosome, various subunits, archaeal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00149340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_8080
WormBaseWBGene000003789.997093137033517e-262locus:cct-2 T-complex protei
n 1 subunit beta status:Conf
irmed UniProt:P47207 prote
in_id:CAA92697.1
Tetrahymena borealisEI9_04994.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (539 aa)
DictyBaseDDB_G02913589.997093137033517e-262cct2 on chromosome: 6 position
177191 to 179304
OxytrichaContig11549.0.g949.997093137033517e-262TCP-1/cpn60 chaperonin family
SGDYIL142W9.997093137033517e-262CCT2 Subunit beta of the cytos
olic chaperonin Cct ring compl
ex, related to Tcp1p, required
for the assembly of actin and
tubulins in vivo

General Information

Paragraph NoGene NameParagraph Text
42CCT2APF1 (Assistant Protein Folder) is homologous with members of the TCP-1/cpn60 chaperonin family and is found in abundance in prokaryotes, chloroplasts and mitochondria. It contains one domain (E-value= 7.8x10-136) that is possibly used to stabilize and protect disassembled polypeptides under heat shock conditions. In addition to its role as a heat shock protein, they may also function to assist in amino acid chain folding into their three-dimensional protein structures. This paragraph was provided by Hannah Chia and Jesse Honig, undergraduates at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

  1. Ref:SUPR000226
  2. Ref:SUPR000170

Sequences

>TTHERM_00149340(coding)
ATGAGCATGGATATGGTTGGTAATGTCTTGCCTCAAGTTCTTAGGAACGAGGCCTCTGAA
GAAAAGGGTGAAATGGCTAGACTTTCATCTTTTGTCGGAGCTATTGCTGTTGCAGATTTA
GTTAAAACCACTTTAGGTCCTAAGGGTATGGATAAAATTCTTAGACCTACTGGCGCTGGT
CCTAAGGCTGACACTATCACTGTCACTAATGATGGTGCTACCATTTTGAGATCTATGTAT
ATTGATAATCCCGCTGCTAAGATTTTAATTGAAATTTCTAAGACTTAAGACGAAGAAGTT
GGTGATGGTACCACTACTGTTGCTGTCTTAGCTGGTGAATTATTAAGAGAAGGTGAAAAA
TTGGTTAACCAAAAGATTCACCCTTAACACATCATCAATGGTTGGAGAAAGGCTAGAGAC
TGTGCTCAACACACTCTTAATTTAATTGCTAGAGATAACTCCAAGAATGAAGAAAAGTTC
AGAGAAGATTTACTTAACATTGCAAGAACTACTCTTTCTTCCAAGCTTTTGACTTAAGAC
AAGGAACACTTTGCTAGATTAGCTGTCGAAGCTGTTCTCAGATTAAGAGGTTCTGGTAAT
CTTGATCAAATCTAAATCATTAAAAAGTCTGGTGGTTCTATCAGAGATTCTTACCTTGCT
GACGGTCTTATTTTAGAAAAGTCCATTACTGTCGGTTGCCCCAAGAGACTTGAAAATGCA
AAGATTATGGTTGCTAACACTCCTATGGATTACGACAAGATTAAGATTTACGGTACCAAG
GTTAAAGTAGAAAGCATGGATAAAATTGCTGAAATTGAAACTGCTGAAAAGGAAAAAATG
AAGGCTAAGGTCGAAAAGATTCTTGCTTACGAACCCACTGTCTTCATTAACAGATAATTG
ATTTATAACTATCCTGAATAAATGTTAGCTGATAAAGGTTTGATGGTTATTGAACACGCT
GATTTCGATGGTATTGAAAGACTTTCCGCTGCTACCGGTGCTGAAATTCTCTCTACTTTC
GATAATCCTGAAAGAGCTGAAAAGATTATGGGTAGATGCAAACTTATTGAAGAAATTATT
ATTGGTGAAGACAAGTTCATTCAATTCTCTGGATGTGAAAAGGGTGAAGCTTGCACTATT
GTCTTGAGAGGTGCTTCTACTCACATTATTGACGAAGCTGATAGATCTCTCCACGATGCA
CTTTGTGTTCTTATTACTACAGTTAAGAACTCTAAGGTTGTCTATGGTGGTGGTAACTCT
GAAATCCAAATGGCTCTTGCTGTTGAAAAGCTTACTTAATCTGTTAAGGGCAAATAAGCA
CTCGCCATTGAAGCATATGCTAGAGCTTTAAGATAATTACCTACTATTATAGCTGATAAT
GGTGGTTATGATGCTCCTGAATTAGTTTAAGCTTTGAAGGTCGAAATCGCTGAAGGTTCT
ACTTCCGCTGGTCTTGATATGATGAACGGTGAAGTTGCTGATATGGAAAAGCTCGGTGTT
ACTGAATGTTTAAGAGTTAAGGAATAGGCTTTATTATCTGCTTCAGAAGCTGCTGAACTT
ATTCTTAGAGTTGATAGCATTATCAGATGTGCTCCTAGAAGAAGAGATAGAATGTGA


>TTHERM_00149340(protein)
MSMDMVGNVLPQVLRNEASEEKGEMARLSSFVGAIAVADLVKTTLGPKGMDKILRPTGAG
PKADTITVTNDGATILRSMYIDNPAAKILIEISKTQDEEVGDGTTTVAVLAGELLREGEK
LVNQKIHPQHIINGWRKARDCAQHTLNLIARDNSKNEEKFREDLLNIARTTLSSKLLTQD
KEHFARLAVEAVLRLRGSGNLDQIQIIKKSGGSIRDSYLADGLILEKSITVGCPKRLENA
KIMVANTPMDYDKIKIYGTKVKVESMDKIAEIETAEKEKMKAKVEKILAYEPTVFINRQL
IYNYPEQMLADKGLMVIEHADFDGIERLSAATGAEILSTFDNPERAEKIMGRCKLIEEII
IGEDKFIQFSGCEKGEACTIVLRGASTHIIDEADRSLHDALCVLITTVKNSKVVYGGGNS
EIQMALAVEKLTQSVKGKQALAIEAYARALRQLPTIIADNGGYDAPELVQALKVEIAEGS
TSAGLDMMNGEVADMEKLGVTECLRVKEQALLSASEAAELILRVDSIIRCAPRRRDRM


>TTHERM_00149340(gene)
ATGAGCATGGATATGGTTGGTGTAAGATTTTCAAAAATTCACAATAAGTAAAAGCTAACT
AACTATATTTTTTATAATTAAATTAACAGAATGTCTTGCCTCAAGTTCTTAGGAACGAGG
CCTCTGAAGAAAAGGGTGAAATGGCTAGACTTGTAATTTTTATTTTTGCTTTTATCCTTA
TCAATTAATTAATTATGTTAATTTACATTCTACTTCAAAAATTAACTTTAATAAATTTTA
AATCTAGTCATCTTTTGTCGGAGCTATTGCTGTTGCAGATTTAGTTAAAACCACTTTAGG
TCCTAAGGGTATGGTAATGAATTAATGCTTTTCGATTTAAGCTAGTTTGATTCTAATTTT
TTTTTATTACTCTAATAGGATAAAATTCTTAGACCTACTGGCGCTGGTCCTAAGGCTGAC
ACTATCACTGTCACTAATGATGGTGCTACCATTTTGAGATCTATGTATATTGATAATCCC
GCTGCTAAGATTTTAATTGGTAATTTACATATTTTTATTGCAACAGAAAGTCTATAGCTA
ATTTGCTTTTCAGTTTATAAACATGCCTTAATCAAGTTTGTTTAGCGAGTTATTAAATAA
ATGCATTAACATTGCAAAGGCGATTAAAAATAAAATTTTAAGGATTAAAGTAGCACGCAT
CAGAAAATAGGATTATCTATTTAAAAGTTTTAAGTTTATTTTCCAGTATGATAAGTGAAG
AATTAGTGAAATGTTTTAAAGTTAGTTTTCAAAAATCTAACAATATAATTGAGAATATCA
TAAAGAAATTATTCTAAACACCTATATTCAACACATTATATAAATTGGTTGAGATAACTT
ATCTTTGAGCACTACACTATACTTCCTTAACTACCATACTGAAAATAAAACAAGCACATA
ATGAATATCTTTCTTTGTTTGCATTTTAGCATAGTTTTAAAAAAATTTAATTCTAATAAA
AATAAATAAATGGTATCTAAAAAATTTATTGATAATAATTAGAAATTTCTAAGACTTAAG
ACGAAGAAGTTGGTGATGGTACCACTACTGTTGCTGTCTTAGCTGGTGAATTATTAAGAG
AAGGTGAAAAATTGGTTAACCAAAAGATTCACCCTTAACACATCATCAATGGTTGGAGAA
AGGCTAGAGACTGTGCTCAACACACTCTTAATTTAATTGCTAGAGATAACTCCAAGAATG
AAGAAAAGTTCAGAGAAGATTTACTTAACATTGCAAGAACTACTCTTTCTTCCAAGCTTT
TGACTTAAGACAAGGAACACTTTGCTAGATTAGCTGTCGAAGCTGTTCTCAGATTAAGAG
GTTCTGGTAATCTTGATCAAATCTAAATCATTAAAAAGTCTGGTGGTTCTATCAGAGATT
CTTACCTTGCTGACGGTCTTATTTTAGAAAAGTCCATTACTGTCGGTTGCCCCAAGAGAC
TTGAAAATGCAAAGTAATTATTTTATTTATTCATTCATTCATTCTTACATATATTCAACA
AAGGATATATAGCTTTATCTTGAATTTATTCAAATTCTAATCAATAAAATTATTATTAAA
AAAATAACTTATTTATTTATTTAACTTAATCTCAAAAGGATTATGGTTGCTAACACTCCT
ATGGATTACGACAAGATTAAGATTTACGGTACCAAGGTTAAAGTAGAAAGCATGGATAAA
ATTGCTGAAATTGAAACTGCTGAAAAGGAAAAAATGAAGGCTAAGGTCGAAAAGATTCTT
GCTTACGAACCCACTGTCTTCATTAACAGATAATTGATTTATAACTATCCTGAATAAATG
TTAGCTGATAAAGGTTTGATGGTTATTGAACACGCTGATTTCGATGGTATTGAAAGACTT
TCCGCTGCTACCGGTGCTGAAATTCTCTCTACTTTCGATAATCCTGAAAGAGCTGAAAAG
ATTATGGGTAGATGCAAACTTATTGAAGAAATTATTATTGGTGAAGACAAGTTCATTCAA
TTCTCTGGATGTGAAAAGGGTGAAGCTTGCACTATTGTCTTGAGAGGTGCTTCTACTCAC
ATTATTGACGAAGCTGATAGATCTCTCCACGATGCACTTTGTGTTCTTATTACTACAGTT
AAGAACTCTAAGGTTGTCTATGGTGGTGGTAACTCTGAAATCCAAATGGCTCTTGCTGTT
GAAAAGCTTACTTAATCTGTTAAGGGCAAATAAGTAATAAATTTTTTTATTTTTATATAT
TTTAATAATATAATTCTGCTTATTAAAATACTTTTGTTTCCAAGTGATTTTGTATTTCAA
TAACTTTTATTTTATAATTTAGGCACTCGCCATTGAAGCATATGCTAGAGCTTTAAGATA
ATTACCTACTATTATAGCTGATAATGGTGGTTATGATGCTCCTGAATTAGTTTAAGCTTT
GAAGGTCGAAATCGCTGAAGGTTCTACTTCCGCTGGTCTTGATATGATGAACGGTGAAGT
TGCTGATATGGAAAAGCTCGGTGTTACTGTAAAAATTTTTATTTAAAAAATTAATATTTA
TCTAAATTATTTATTTTAAAATCTAAAGGAATGTTTAAGAGTTAAGGAATAGGCTTTATT
ATCTGCTTCAGAAGCTGCTGAACTTATTCTTAGAGTTGATAGCATTATCAGATGTGCTCC
TAGAAGAAGAGATAGAATGTGA