Identifiers and Description

Gene Model Identifier

TTHERM_00777270

Standard Name

CCP1 (Cytoplasmic Cytoskeletal Protein 1)

Aliases

PreTt21141 | 129.m00112

Description

Constitutively localized throughout cytoplasm. Hypothesized to act as a membrane cytoskeletal protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00777270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09508.12.0003615238957836e-139hypothetical protein (2107 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00777270(coding)
ATGTAAAAATAAGAACTTATAGTTACAATTAGACCTGCTTATAACCCTACCCATTATTTA
TTCCCTGCAAATGATGGTTCAAGGGCTTATAACTAAGACTTTGATGTTAGAACTCATGCT
AGTTAAGAGCAAAGAAACCAATTAATCCTTACTCGTGTCAAGGATAATGTCTTCACAATT
AAATCTGCTACTAATCCTACTCACTACATGTTTGCTTCTAATGATAGTCACAGATCTGAT
GGAAAAGATTTTGATGTCAGAACTCATGCTTCAGATGAAGAAAGAAATCAATGGATTATT
GAAGAATACGCCTAAGGATTCCATATTAGAGTTTATACCAATCCTACTCACTACTTATTC
CCTGCCAACGACGGTTCTAATGGCTTAGGAGCTGATTTTGATGTTAGAACTCATCCCCAC
AAGGAAGAAAGAAATCTTTGGTTTATTGATGGTCTTATCTATGCTCCTCCTACTTAAAAA
ACTACTCTTAGAGTTAAGGCTAATCCTAATCACTTCATGTTTGCCTCAAACGATGGTGTT
AGAGGATTAAATAAAGATTTTGATGTTAGAACTCATGCCAGCTCTGAAGAAAGAAATTTC
ATCTTAATCCATCATGTCGGTCATCACGTATATACTCTTGCCAGTGCTACTAATCCTAAT
CACTTTTTCTTCCCCTCTGATGATGGAACTAGAGCTTATGCCCACGATTTTGACGTCAGA
ACTCATACTTATCAAGAAGAAAGAAACAAATGGATTATTGAAAGTGATAATCAAGGAGGC
TTCTTCATTAGATCTTTTGTCAAACCCTAACACTACTTATTTGCTGCTAACGATGGTTCA
AATAGCTACGGTGGTGACTTCGATGTCAGAACTCATGCCAGCTAAGAAGCTAGAAACGCT
TGGATTATTGATGGTTTTGTTTTACATAACTACTGA


>TTHERM_00777270(protein)
MQKQELIVTIRPAYNPTHYLFPANDGSRAYNQDFDVRTHASQEQRNQLILTRVKDNVFTI
KSATNPTHYMFASNDSHRSDGKDFDVRTHASDEERNQWIIEEYAQGFHIRVYTNPTHYLF
PANDGSNGLGADFDVRTHPHKEERNLWFIDGLIYAPPTQKTTLRVKANPNHFMFASNDGV
RGLNKDFDVRTHASSEERNFILIHHVGHHVYTLASATNPNHFFFPSDDGTRAYAHDFDVR
THTYQEERNKWIIESDNQGGFFIRSFVKPQHYLFAANDGSNSYGGDFDVRTHASQEARNA
WIIDGFVLHNY


>TTHERM_00777270(gene)
ATGTAAAAATAAGAACTTATAGTTACAATTAGACCTGCTTATAACCCTACCCATTATTTA
TTCCCTGCAAATGATGGTTCAAGGGCTTATAACTAAGACTTTGATGTTAGAACTCATGCT
AGTTAAGAGCAAAGAAACCAATTAATCCTTACTCGTGTCAAGGATAATGTCTTCACAATT
AAATCTGCTACTAATCCTACTCACTACATGTTTGCTTCTAATGATAGTCACAGATCTGAT
GGAAAAGATTTTGATGTCAGAACTCATGCTTCAGATGAAGAAAGAAATCAATGGATTATT
GAAGAATACGCCTAAGGATTCCATATTAGAGTTTATACCAATCCTACTCACTACTTATTC
CCTGCCAACGACGGTTCTAATGGCTTAGGAGCTGATTTTGATGTTAGAACTCATCCCCAC
AAGGAAGAAAGAAATCTTTGGTTTATTGATGGTCTTATCTATGCTCCTCCTACTTAAAAA
ACTACTCTTAGAGTTAAGGCTAATCCTAATCACTTCATGTTTGCCTCAAACGATGGTGTT
AGAGGATTAAATAAAGATTTTGATGTTAGAACTCATGCCAGCTCTGAAGAAAGAAATTTC
ATCTTAATCCATCATGTCGGTCATCACGTATATACTCTTGCCAGTGCTACTAATCCTAAT
CACTTTTTCTTCCCCTCTGATGATGGAACTAGAGCTTATGCCCACGATTTTGACGTCAGA
ACTCATACTTATCAAGAAGAAAGAAACAAATGGATTATTGAAAGTGATAATCAAGGAGGC
TTCTTCATTAGATCTTTTGTCAAACCCTAACACTACTTATTTGCTGCTAACGATGGTTCA
AATAGCTACGGTGGTGACTTCGATGTCAGAACTCATGCCAGCTAAGAAGCTAGAAACGCT
TGGATTATTGATGGTTTTGTTTTACATAACTACTGA