Identifiers and Description

Gene Model Identifier

TTHERM_00038880

Standard Name

CCF9 (C-terminal Crystallin Fold 9)

Aliases

PreTt14523 | 2.m02240 | 3825.m02892

Description

CCF9 carboxy-terminal crystallin fold protein 9p; C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and tandem 80-residue motif with 6 cysteines conserved among CCF9- CCF10- CCF11- and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25.8%

TetraMine Data

TTHERM_00038880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05799.14.997593565024277e-70hypothetical protein (772 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00038880(coding)
ATGAAGGGCAAAAACGGATTAGTGAGGCTGAAGTTCATATTAAAAATTCAAAGAGCTATT
ATAGTTGGGTAATACAAAAACCCTCAGAAAATAATTAAAAGCATAAGACTTAAATTGAAT
ATATTATGCAATATATATGTATCGGTGAATTAAAAAACAGAAATAATAAAAAACAAAAAC
AAAAAAATTAATTAAATTGAATATTTTATTTGCTCACCTTTTAGTATGAGAAATTTGAGT
GTTTTACTTATTTTAGGATTAATTATAAGTTAAGTCTATTGTGGCTGCGCTTATACAAAC
GGATATGGCTAGTACAGTGGATCTTGTTACAATAATTGTTAAGATTTTGCCAAACTGTCT
GATGCTTTTGCTGCATGTGACGCTTCTAATAATTGTGGTGGTGTTTCCTATAGTTATAAA
TCAATTGGTGGTAGTGCTGCTACTAATGCAATTGGTAATGGATGGGGTTATCAACTCAGA
GCTTCAAAAACAGGTAGTAAATCTCCAAACAAGGAAAATTCCTGGTTAAAGTCTACTTGC
CCTGATCCTCAAACTACTTTCGATCCCTGCGATTATACTTAAGGTTAAGGTGTTTTCTTA
GGAGGCTGCAATTAAAATTGCAAAGATTTCTCAAATTTGAATGATGCTCTTGCTGCTTGT
AGAGCTGATTCTTCCTGTGGTGGTGTTACCTTCTCCAGAAAAGATATTGGTGGTGGTGCT
GCTACTAATGCTTTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCTGGAACTACTTTCTAA
CTTTCACCAAATGGAGAAAACTCATGGGTTAAATCTAAGTGCCCTGTTTAATAAGTTTAA
GGAACTTACTGTAACTATTCTAAGTAATCTTATCAAACCTTTGCAAGCTTGATTCAAGCT
GCTTCATATGCAAGTGAATCTTTAGCATTGGCTGCATGTGACTCTAGAAGTGATTGCGTT
GGTGTTCTTTAAAGCTAAGGAACATTCTACCTAGCTACTGGCTCTTCATCTCCTAGTGCT
AATAACAGCGTTGCTTACACAAGAGGAACCTGCAATGTTGTTGCTAACCCTATCCTCTTC
AGTGGATGCAATTTCACAGGTGATTAAGTCTAAATAACTCAAGATATTTCAAAGATCGAT
TTGAGTAAATACAAGAGTTTGTATGTTCCTGCTGGTAAGTATGTCAGATTCTACTCCCAA
GAAAATTACAAGGGATCTTCTAACGACAACAAGAATTCTATCTACTGCTAAGGATCAGGC
TTAGTTTCTGCTTTCATTTAAACCGCTCATTCCTACGGTAAATCTTACGAAACTTCAATC
TAAGTTAGAGATCTCTTCACTGCCAATAAGATTTCCAGAAAACTTAAACCTAATCAAAAC
TGA


>TTHERM_00038880(protein)
MKGKNGLVRLKFILKIQRAIIVGQYKNPQKIIKSIRLKLNILCNIYVSVNQKTEIIKNKN
KKINQIEYFICSPFSMRNLSVLLILGLIISQVYCGCAYTNGYGQYSGSCYNNCQDFAKLS
DAFAACDASNNCGGVSYSYKSIGGSAATNAIGNGWGYQLRASKTGSKSPNKENSWLKSTC
PDPQTTFDPCDYTQGQGVFLGGCNQNCKDFSNLNDALAACRADSSCGGVTFSRKDIGGGA
ATNAFDGVWGFQLRAGTTFQLSPNGENSWVKSKCPVQQVQGTYCNYSKQSYQTFASLIQA
ASYASESLALAACDSRSDCVGVLQSQGTFYLATGSSSPSANNSVAYTRGTCNVVANPILF
SGCNFTGDQVQITQDISKIDLSKYKSLYVPAGKYVRFYSQENYKGSSNDNKNSIYCQGSG
LVSAFIQTAHSYGKSYETSIQVRDLFTANKISRKLKPNQN


>TTHERM_00038880(gene)
ATGAAGGGCAAAAACGGATTAGTGAGGCTGAAGTTCATATTAAAAATTCAAAGAGCTATT
ATAGTTGGGTAATACAAAAACCCTCAGAAAATAATTAAAAGCATAAGACTTAAATTGAAT
ATATTATGCAATATATATGTATCGGTGAATTAAAAAACAGAAATAATAAAAAACAAAAAC
AAAAAAATTAATTAAATTGAATATTTTATTTGCTCACCTTTTAGTATGAGAAATTTGAGT
GTTTTACTTATTTTAGGATTAATTATAAGTTAAGTCTATTGTGGCTGCGCTTATACAAAC
GGATATGGCTAGTACAGTGGATCTTGTTACAATAATTGTTAAGATTTTGCCAAACTGTCT
GATGCTTTTGCTGCATGTGACGCTTCTAATAATTGTGGTGGTGTTTCCTATAGTTATAAA
TCAATTGGTGGTAGTGCTGCTACTAATGCAATTGGTAATGGATGGGGTTATCAACTCAGA
GCTTCAAAAACAGGTAGTAAATCTCCAAACAAGGAAAATTCCTGGTTAAAGTCTACTTGC
CCTGATCCTCAAACTACTTTCGATCCCTGCGATTATACTTAAGGTTAAGGTGTTTTCTTA
GGAGGCTGCAATTAAAATTGCAAAGATTTCTCAAATTTGAATGATGCTCTTGCTGCTTGT
AGAGCTGATTCTTCCTGTGGTGGTGTTACCTTCTCCAGAAAAGATATTGGTGGTGGTGCT
GCTACTAATGCTTTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCTGGAACTACTTTCTAA
CTTTCACCAAATGGAGAAAACTCATGGGTTAAATCTAAGTGCCCTGTTTAATAAGTTTAA
GGAACTTACTGTAACTATTCTAAGTAATCTTATCAAACCTTTGCAAGCTTGATTCAAGCT
GCTTCATATGCAAGTGAATCTTTAGCATTGGCTGCATGTGACTCTAGAAGTGATTGCGTT
GGTGTTCTTTAAAGCTAAGGAACATTCTACCTAGCTACTGGCTCTTCATCTCCTAGTGCT
AATAACAGCGTTGCTTACACAAGAGGAACCTGCAATGTTGTTGCTAACCCTATCCTCTTC
AGTGGATGCAATTTCACAGGTGATTAAGTCTAAATAACTCAAGATATTTCAAAGATCGAT
TTGAGTAAATACAAGAGTTTGTATGTTCCTGCTGGTAAGTATGTCAGATTCTACTCCCAA
GAAAATTACAAGGGATCTTCTAACGACAACAAGAATTCTATCTACTGCTAAGGATCAGGC
TTAGTTTCTGCTTTCATTTAAACCGCTCATTCCTACGGTAAATCTTACGAAACTTCAATC
TAAGTTAGAGATCTCTTCACTGCCAATAAGATTTCCAGAAAACTTAAACCTAATCAAAAC
TGA