Identifiers and Description

Gene Model Identifier

TTHERM_00038880

Standard Name

CCF9 (C-terminal Crystallin Fold)

Aliases

PreTt14523 | 2.m02240 | 3825.m02892

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and tandem 80-residue motif with 6 cysteines conserved among CCF9, CCF10, CCF11, and CCF12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 25.8%

TetraMine Data

TTHERM_00038880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05799.14.997593565024277e-70hypothetical protein (772 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00038880(coding)
ATGAAGGGCAAAAACGGATTAGTGAGGCTGAAGTTCATATTAAAAATTCAAAGAGCTATT
ATAGTTGGGTAATACAAAAACCCTCAGAAAATAATTAAAAGCATAAGACTTAAATTGAAT
ATATTATGCAATATATATGTATCGGTGAATTAAAAAACAGAAATAATAAAAAACAAAAAC
AAAAAAATTAATTAAATTGAATATTTTATTTGCTCACCTTTTAGTATGAGAAATTTGAGT
GTTTTACTTATTTTAGGATTAATTATAAGTTAAGTCTATTGTGGCTGCGCTTATACAAAC
GGATATGGCTAGTACAGTGGATCTTGTTACAATAATTGTTAAGATTTTGCCAAACTGTCT
GATGCTTTTGCTGCATGTGACGCTTCTAATAATTGTGGTGGTGTTTCCTATAGTTATAAA
TCAATTGGTGGTAGTGCTGCTACTAATGCAATTGGTAATGGATGGGGTTATCAACTCAGA
GCTTCAAAAACAGGTAGTAAATCTCCAAACAAGGAAAATTCCTGGTTAAAGTCTACTTGC
CCTGATCCTCAAACTACTTTCGATCCCTGCGATTATACTTAAGGTTAAGGTGTTTTCTTA
GGAGGCTGCAATTAAAATTGCAAAGATTTCTCAAATTTGAATGATGCTCTTGCTGCTTGT
AGAGCTGATTCTTCCTGTGGTGGTGTTACCTTCTCCAGAAAAGATATTGGTGGTGGTGCT
GCTACTAATGCTTTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCTGGAACTACTTTCTAA
CTTTCACCAAATGGAGAAAACTCATGGGTTAAATCTAAGTGCCCTGTTTAATAAGTTTAA
GGAACTTACTGTAACTATTCTAAGTAATCTTATCAAACCTTTGCAAGCTTGATTCAAGCT
GCTTCATATGCAAGTGAATCTTTAGCATTGGCTGCATGTGACTCTAGAAGTGATTGCGTT
GGTGTTCTTTAAAGCTAAGGAACATTCTACCTAGCTACTGGCTCTTCATCTCCTAGTGCT
AATAACAGCGTTGCTTACACAAGAGGAACCTGCAATGTTGTTGCTAACCCTATCCTCTTC
AGTGGATGCAATTTCACAGGTGATTAAGTCTAAATAACTCAAGATATTTCAAAGATCGAT
TTGAGTAAATACAAGAGTTTGTATGTTCCTGCTGGTAAGTATGTCAGATTCTACTCCCAA
GAAAATTACAAGGGATCTTCTAACGACAACAAGAATTCTATCTACTGCTAAGGATCAGGC
TTAGTTTCTGCTTTCATTTAAACCGCTCATTCCTACGGTAAATCTTACGAAACTTCAATC
TAAGTTAGAGATCTCTTCACTGCCAATAAGATTTCCAGAAAACTTAAACCTAATCAAAAC
TGA


>TTHERM_00038880(protein)
MKGKNGLVRLKFILKIQRAIIVGQYKNPQKIIKSIRLKLNILCNIYVSVNQKTEIIKNKN
KKINQIEYFICSPFSMRNLSVLLILGLIISQVYCGCAYTNGYGQYSGSCYNNCQDFAKLS
DAFAACDASNNCGGVSYSYKSIGGSAATNAIGNGWGYQLRASKTGSKSPNKENSWLKSTC
PDPQTTFDPCDYTQGQGVFLGGCNQNCKDFSNLNDALAACRADSSCGGVTFSRKDIGGGA
ATNAFDGVWGFQLRAGTTFQLSPNGENSWVKSKCPVQQVQGTYCNYSKQSYQTFASLIQA
ASYASESLALAACDSRSDCVGVLQSQGTFYLATGSSSPSANNSVAYTRGTCNVVANPILF
SGCNFTGDQVQITQDISKIDLSKYKSLYVPAGKYVRFYSQENYKGSSNDNKNSIYCQGSG
LVSAFIQTAHSYGKSYETSIQVRDLFTANKISRKLKPNQN


>TTHERM_00038880(gene)
ATGAAGGGCAAAAACGGATTAGTGAGGCTGAAGTTCATATTAAAAATTCAAAGAGCTATT
ATAGTTGGGTAATACAAAAACCCTCAGAAAATAATTAAAAGCATAAGACTTAAATTGAAT
ATATTATGCAATATATATGTATCGGTGAATTAAAAAACAGAAATAATAAAAAACAAAAAC
AAAAAAATTAATTAAATTGAATATTTTATTTGCTCACCTTTTAGTATGAGAAATTTGAGT
GTTTTACTTATTTTAGGATTAATTATAAGTTAAGTCTATTGTGGCTGCGCTTATACAAAC
GGATATGGCTAGTACAGTGGATCTTGTTACAATAATTGTTAAGATTTTGCCAAACTGTCT
GATGCTTTTGCTGCATGTGACGCTTCTAATAATTGTGGTGGTGTTTCCTATAGTTATAAA
TCAATTGGTGGTAGTGCTGCTACTAATGCAATTGGTAATGGATGGGGTTATCAACTCAGA
GCTTCAAAAACAGGTAGTAAATCTCCAAACAAGGAAAATTCCTGGTTAAAGTCTACTTGC
CCTGATCCTCAAACTACTTTCGATCCCTGCGATTATACTTAAGGTTAAGGTGTTTTCTTA
GGAGGCTGCAATTAAAATTGCAAAGATTTCTCAAATTTGAATGATGCTCTTGCTGCTTGT
AGAGCTGATTCTTCCTGTGGTGGTGTTACCTTCTCCAGAAAAGATATTGGTGGTGGTGCT
GCTACTAATGCTTTTGATGGTGTTTGGGGTTTCTAGTTAAGAGCTGGAACTACTTTCTAA
CTTTCACCAAATGGAGAAAACTCATGGGTTAAATCTAAGTGCCCTGTTTAATAAGTTTAA
GGAACTTACTGTAACTATTCTAAGTAATCTTATCAAACCTTTGCAAGCTTGATTCAAGCT
GCTTCATATGCAAGTGAATCTTTAGCATTGGCTGCATGTGACTCTAGAAGTGATTGCGTT
GGTGTTCTTTAAAGCTAAGGAACATTCTACCTAGCTACTGGCTCTTCATCTCCTAGTGCT
AATAACAGCGTTGCTTACACAAGAGGAACCTGCAATGTTGTTGCTAACCCTATCCTCTTC
AGTGGATGCAATTTCACAGGTGATTAAGTCTAAATAACTCAAGATATTTCAAAGATCGAT
TTGAGTAAATACAAGAGTTTGTATGTTCCTGCTGGTAAGTATGTCAGATTCTACTCCCAA
GAAAATTACAAGGGATCTTCTAACGACAACAAGAATTCTATCTACTGCTAAGGATCAGGC
TTAGTTTCTGCTTTCATTTAAACCGCTCATTCCTACGGTAAATCTTACGAAACTTCAATC
TAAGTTAGAGATCTCTTCACTGCCAATAAGATTTCCAGAAAACTTAAACCTAATCAAAAC
TGA