Identifiers and Description

Gene Model Identifier

TTHERM_00471040

Standard Name

CCF8 (C-terminal Crystallin Fold 8)

Aliases

PreTt22518 | 56.m00222 | 3686.m00065

Description

CCF8 Putative 8-oxo-dGTP diphosphatase; C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains four copies of a 200-residue motif weakly conserved among CCF6- CCF7- CCF8- and IGR1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 88.6%

TetraMine Data

TTHERM_00471040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11335.19.997093137033517e-262hypothetical protein (974 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00471040(coding)
ATGAGTAGGAGAGTCCAATAAATGCTATTAATTATAGCTCTTTTAGGTACTCTTTAGGTT
GTCACATCTTAAAAAATTATTGTATCAAGCTACATTCAAGCCAAAGCTTAAAATGTGATT
ACAGTACCTAAAGATTAACTATCATAAATTAAATCACTTTCGATTGAAGGTTGGGTTCGC
CCTTCTTAAACTATGGATTACCCATATCCCGCATCTGTTCCAAGAAAGAGTTATTCTTTA
ATTATGGGTTCTAGTACTTCTAGTTCTGGTTGGGGTGATAATGTTAAGGGAGTTGACTCA
TTTTTGAACTTATACACAAATAAGTGGACAGATCAATCCGGCTTTATTTTAGCCTATGAA
AATGGAAAGAACTTCGAATACATTTACAATAACTTAAGATATGCTGATTTCTTTGGTCGT
TGGTTTTTTGTCTACGGTGTCTATCTTAGTGATATATAAAAACATTATTTAGTAACTTAT
AGCGCTTATGACGAATCTTGGTAAGAGGCTATTTCATCTGTTGTAAAGAAAAATCCCATC
ATCGACTTTTATCAATTTAGTGTTAACTCTTAAGATGTTAAAAAGTCAGTTTAATTCAAT
GGATATATTGCTGATCCAAATTTGACATATTCAGCTTCTTCCTCTTACTATAGCTCTTTA
GATTAACTAAAGGCATACATTTCATAAAAATAATAAAAACCAAAATATATTGGAGTACTT
TAAAAAACAGTATTCACATACATTGGTCAAAGTGCTACCATACCAGATGGTGGTTTATAT
GAGTCTTTCGGTAATTACTAAGGAGCAGATGAATACTCAATTAATGGTTAAGCTCAATTT
ACTGGTGCTTTCGCATCTGTTGGTAATACTATCTTATTTAGACTTGGCACAAATAACCCA
GAAGTCTTCAAAAGTTTCTACGAAGAAGGAGATCTTGCTTTGTTAGCCTATGTTTAAAAT
GGTAAAAAAACTTGTATGCAAACTTATCGTATTAATCTGTCAGCAACTGATTTAACAAAC
GGTAAACAATGTTTTGATGTTGTTCCTAAGAAGGGAGAGTGGTTTTACTTCTATTAAGGT
TACAGCAGAAAACTTGGAAGAGTTTTTAACTATGTTAGAATTGGTGGTTAAAACTATTAT
GCTGCTACCACAGATGTTCTTCACGTTGATCCAAATGCTTTCTATTTATTCGTTGGTCAA
GATTCTGTTAGTATGAAATGGGCTGGTTCATTCTAAGGTTTTAACTTAGAATTTGGTCCT
GGTGCTTACAGAGAAACCCTAATCACTGAATTCCCTCCTGTTAAAGATAAATCAGTTAAA
GATAAAGTTGTCATTCCTAAGACATATGTTGATCCTTAAATCTTATAATCAAAGGCTTCC
TAAACTTTAGCTATTGATGCTAAAATTGTCAGCCAAAACTACATTAGTAGTGTAAAGGAA
TATGCTATTCATTTCTGGTTCAGAAGAGACTTAATTACTCCAGAATTAATTGACTTCTAA
GCAGCTAAATCATAATAATCTGTTGCAGGTGTTACAGAACGTGATGATTACACAAGTACT
GATGTTGCAGGAGATGCCGCTCTTTCAATTCAATATCTCGATCATTCTAAAGGTGATTCT
CCAGCTTTTGTTTTCACAACTTATAATGATGCAGGTTCAGACAAATTCAAATCAGCTACA
GTTAATTTTGATACTAAGTTCGATTAAGGTTAATGGATTTGGGTTTATTTTGCTTATAGC
TAACCTTTGCAATAAGCTAGTATTTATGTTGGATTACCTGATGGCTAAACAAAGATTGTT
AAACAGATTAACTAAGTAAGCCACTCATAAGCTCATAACTTAAAAGCTCTTATCGGAAGG
TCTGGTACAACAATGAACCCAGTAACAGGTCAATTTTACGATGCTTAATTCGTCTATTAT
GATGGATGTTATCAATCTTCCACTGCTACTATTGAAAACTATAAGGCTGCTAATGTCAAA
AATCCTCCTTCCACTCAACCAAAATAAGGTGTTTACAGTGCTTTTGATAGAAAATCATTT
AGCAAAAAAAATCCTCCTACATAAAACCCTAATTAATTCACCACTGAAGTTGCTGGTGCT
TTACAATATGGTTTAGCTGCTTGGGCTAGATGGAATAAGTCTTCCTTAAAGAATGCAGCT
GGTAATTTATTATTTACACTCTCGATTTACGATAAGACAACCATTGGAAAGACATATAAC
AAACTTGGTTCTCTTGTTCTCTAAGTTTATTACAAGAAAAAATACTTGTACTTTTCAACT
TACTAATACGTTCATGCTAAATTGAAAGATGTCAATCCTGCTGTTCAAAAATTCTTTGTT
CCAAAGAATGCTCGTACTTCTTGGTGTTATTACTACTTTGGATATTCTCACTTAGATCAA
TAAGCAGTTGGATCTGTCAAATGCTTATCAGGATTTTAACATGAAGTCAAATTTGATAAT
ACTAATCACATTATTCCATCAGCTTTTACCTTCCAAGTAGCCAAAGATGACATTTTAAAC
ATATGGAAAGGAGAAGTATATCAACCCTCTGTTATTATAGGATATCCTGTTGCTTTGAAC
TTTTAATATGATAACGCTTATTATCCTTAAGACCCTTCAAGCGGCTCTTTACCAGATGAT
GATGATTCTGGCAATAAGCAACCTGATGAAGGAGATGATGACGAACCAGAAGAAGAAGAT
GATCCAAAAGTCCCATCCAAGCCAGCAACTGACCCTTCCACTCCTGCTACCAACACAACC
ACTCCTGTAACTAATCCAGTTAATCCTGCAACTAACTCAACTACTCCTGTAACTAACACA
ACTACTCCTGAAACTAACCCAATTATTCCTGCAACTAACACAACCATTCCTGCAACTAAC
ACAACTACTCCTGCAACTAACACAACCACTCCTGATGTTACCCCAGTTATTCCTGCAACT
AACACAACCACTCCTGCTACTAACACAACCACTCCTGCTACTAACACAACTACTCCTACT
TAACCTTAATAGCCTAGTTGTGCAGTTATTTATTCAGAATGTGGTTACACTAATAAGATT
TAAGAAGTTTGTTAGAATATCCCTAGTTTAGAAATTAGAAATATTAGAAGTATTCAAGTA
CCTAATGGAACAACTCTTAAATTCTTCCAAAAAGAAAACTATAAAGGTGTTAATGTTAAA
TTTTTGTAAAGCGTAGAATGCATTGAATTAGGTTTGAAAGAAGACCCTAAAATTTAATGG
GATGATTTAGTAAAATTATTTAATGCTGGAAAAATCGGATTTATTGATTCAGAAGGTAAT
GATATTGGGCTTCACAAAGCTAAAAAAGTATTCTTTAAGACAAATCTAAGAATGTAACTT
AGAAAGAAACACTCAAGTGATTGA


>TTHERM_00471040(protein)
MSRRVQQMLLIIALLGTLQVVTSQKIIVSSYIQAKAQNVITVPKDQLSQIKSLSIEGWVR
PSQTMDYPYPASVPRKSYSLIMGSSTSSSGWGDNVKGVDSFLNLYTNKWTDQSGFILAYE
NGKNFEYIYNNLRYADFFGRWFFVYGVYLSDIQKHYLVTYSAYDESWQEAISSVVKKNPI
IDFYQFSVNSQDVKKSVQFNGYIADPNLTYSASSSYYSSLDQLKAYISQKQQKPKYIGVL
QKTVFTYIGQSATIPDGGLYESFGNYQGADEYSINGQAQFTGAFASVGNTILFRLGTNNP
EVFKSFYEEGDLALLAYVQNGKKTCMQTYRINLSATDLTNGKQCFDVVPKKGEWFYFYQG
YSRKLGRVFNYVRIGGQNYYAATTDVLHVDPNAFYLFVGQDSVSMKWAGSFQGFNLEFGP
GAYRETLITEFPPVKDKSVKDKVVIPKTYVDPQILQSKASQTLAIDAKIVSQNYISSVKE
YAIHFWFRRDLITPELIDFQAAKSQQSVAGVTERDDYTSTDVAGDAALSIQYLDHSKGDS
PAFVFTTYNDAGSDKFKSATVNFDTKFDQGQWIWVYFAYSQPLQQASIYVGLPDGQTKIV
KQINQVSHSQAHNLKALIGRSGTTMNPVTGQFYDAQFVYYDGCYQSSTATIENYKAANVK
NPPSTQPKQGVYSAFDRKSFSKKNPPTQNPNQFTTEVAGALQYGLAAWARWNKSSLKNAA
GNLLFTLSIYDKTTIGKTYNKLGSLVLQVYYKKKYLYFSTYQYVHAKLKDVNPAVQKFFV
PKNARTSWCYYYFGYSHLDQQAVGSVKCLSGFQHEVKFDNTNHIIPSAFTFQVAKDDILN
IWKGEVYQPSVIIGYPVALNFQYDNAYYPQDPSSGSLPDDDDSGNKQPDEGDDDEPEEED
DPKVPSKPATDPSTPATNTTTPVTNPVNPATNSTTPVTNTTTPETNPIIPATNTTIPATN
TTTPATNTTTPDVTPVIPATNTTTPATNTTTPATNTTTPTQPQQPSCAVIYSECGYTNKI
QEVCQNIPSLEIRNIRSIQVPNGTTLKFFQKENYKGVNVKFLQSVECIELGLKEDPKIQW
DDLVKLFNAGKIGFIDSEGNDIGLHKAKKVFFKTNLRMQLRKKHSSD


>TTHERM_00471040(gene)
ATGAGTAGGAGAGTCCAATAAATGCTATTAATTATAGCTCTTTTAGGTACTCTTTAGGTT
GTCACATCTTAAAAAATTATTGTATCAAGCTACATTCAAGCCAAAGCTTAAAATGTGATT
ACAGTACCTAAAGATTAACTATCATAAATTAAATCACTTTCGATTGAAGGTTGGGTTCGC
CCTTCTTAAACTATGGATTACCCATATCCCGCATCTGTTCCAAGAAAGAGTTATTCTTTA
ATTATGGGTTCTAGTACTTCTAGTTCTGGTTGGGGTGATAATGTTAAGGGAGTTGACTCA
TTTTTGAACTTATACACAAATAAGTGGACAGATCAATCCGGCTTTATTTTAGCCTATGAA
AATGGAAAGAACTTCGAATACATTTACAATAACTTAAGATATGCTGATTTCTTTGGTCGT
TGGTTTTTTGTCTACGGTGTCTATCTTAGTGATATATAAAAACATTATTTAGTAACTTAT
AGCGCTTATGACGAATCTTGGTAAGAGGCTATTTCATCTGTTGTAAAGAAAAATCCCATC
ATCGACTTTTATCAATTTAGTGTTAACTCTTAAGATGTTAAAAAGTCAGTTTAATTCAAT
GGATATATTGCTGATCCAAATTTGACATATTCAGCTTCTTCCTCTTACTATAGCTCTTTA
GATTAACTAAAGGCATACATTTCATAAAAATAATAAAAACCAAAATATATTGGAGTACTT
TAAAAAACAGTATTCACATACATTGGTCAAAGTGCTACCATACCAGATGGTGGTTTATAT
GAGTCTTTCGGTAATTACTAAGGAGCAGATGAATACTCAATTAATGGTTAAGCTCAGTAA
TTAATTTTTATATCCTTTAAATAAAAAAATTATAAAAAAAATAAATTAATTTATCAAATA
AAAATATAAAATTAGATTTACTGGTGCTTTCGCATCTGTTGGTAATACTATCTTATTTAG
ACTTGGCACAAATAACCCAGAAGTCTTCAAAAGTTTCTACGAAGAAGGAGATCTGTAAGA
AATTAATTGTTATATATATTAACAAAATTTAAATTTATTTTTATAATTTTTTAGTGCTTT
GTTAGCCTATGTTTAAAATGGTAAAAAAACTTGTATGCAAACTTATCGTATTAATCTGTC
AGCAACTGATTTAACAAACGGTAAACAATGTTTTGATGTTGTTCCTAAGAAGGGAGAGTG
GTTTTACTTCTATTAAGGTTACAGCAGAAAACTTGGAAGAGTTTTTAACTATGTTAGAAT
TGGTGGTTAAAACTATTATGCTGCTACCACAGATGTTCTTCACGTTGATCCAAATGCTTT
CTATTTATTCGTTGGTCAAGATTCTGTTAGTATGAAATGGGCTGGTTCATTCTAAGGTTT
TAACTTAGAATTTGGTCCTGGTGCTTACAGAGAAACCCTAATCACTGAATTCCCTCCTGT
TAAAGATAAATCAGTTAAAGATAAAGGTAATCATATATTTTATTTAGACAAAACACTAAT
AAAGCAATTTAATTTTAATTATAGTTGTCATTCCTAAGACATATGTTGATCCTTAAATCT
TATAATCAAAGGCTTCCTAAACTTTAGCTATTGATGCTAAAATTGTCAGCCAAAACTACA
TTAGTAGTGTAAAGGAATATGCTATTCATTTCTGGTTCAGAAGAGACTTAATTACTCCAG
AATTAATTGACTTCTAAGCAGCTAAATCATAATAATCTGTTGCAGGTGTTACAGAACGTG
ATGATTACACAAGTACTGATGTTGCAGGAGATGCCGCTCTTTCAATTCAATATCTCGATC
ATTCTAAAGGTGATTCTCCAGCTTTTGTTTTCACAACTTATAATGATGCAGGTTCAGACA
AATTCAAATCAGCTACAGTTAATTTTGATACTAAGTTCGATTAAGGTTAATGGATTTGGG
TTTATTTTGCTTATAGCTAACCTTTGCAATAAGCTAGTATTTATGTTGGATTACCTGATG
GCTAAACAAAGATTGTTAAACAGATTAACTAAGTAAGCCACTCATAAGCTCATAACTTAA
AAGCTCTTATCGTAATTTAATAAAGCATTATTTTCAAGATTTAATTATTTTAACTAATCA
AATATAGGGAAGGTCTGGTACAACAATGAACCCAGTAACAGGTCAATTTTACGATGCTTA
ATTCGTCTATTATGATGGATGTTATCAATCTTCCACTGCTACTATTGAAAACTATAAGGC
TGCTAATGTCAAAAATCCTCCTTCCACTCAACCAAAATAAGGTGTTTACAGTGCTTTTGA
TAGAAAATCATTTAGCAAAAAAAATCCGTAAAATTTTTCAATATTTTTAATTGTGATAAC
TTATTAAATTTTTAATTTAATAGTCCTACATAAAACCCTAATTAATTCACCACTGAAGTT
GCTGGTGCTTTACAATATGGTTTAGCTGCTTGGGCTAGATGGAATAAGTCTTCCTTAAAG
AATGCAGCTGGTAATTTATTATTTACACTCTCGATTTACGATAAGACAACCATTGGAAAG
ACATATAACAAACTTGGTTCTCTTGTTCTCTAAGTTTATTACAAGAAAAAATACTTGTAC
TTTTCAACTTACTAATACGTTCATGCTAAATTGAAAGATGTCAATCCTGCTGTTCAAAAA
TTCGTAATTTATTGTTTATATATTTGTATTTTAAAATAAGTTTAATAAATTTTGTCAAAT
TAAATTAGTTTGTTCCAAAGAATGCTCGTACTTCTTGGTGTTATTACTACTTTGGATATT
CTCACTTAGATCAATAAGCAGTTGGATCTGTCAAATGCTTATCAGGATTTTAACATGAAG
TCAAATTTGATAATACTAATCACATTATTCCATCAGCTTTTACCTTCCAAGTAGCCAAAG
ATGACATTTTAAACATATGTAAAATTATAATAAAGTTTTTAATAGCTTAATAAATTTATT
ATTGTTTTGAATTTTAGGGAAAGGAGAAGTATATCAACCCTCTGTTATTATAGGATATCC
TGTTGCTTTGAACTTTTAATATGATAACGCTTATTATCCTTAAGACCCTTCAAGCGGCTC
TTTACCAGATGATGATGATTCTGGCAATAAGCAACCTGATGAAGGAGATGATGACGAACC
AGAAGAAGAAGATGATCCAAAAGTCCCATCCAAGCCAGCAACTGACCCTTCCACTCCTGC
TACCAACACAACCACTCCTGTAACTAATCCAGTTAATCCTGCAACTAACTCAACTACTCC
TGTAACTAACACAACTACTCCTGAAACTAACCCAATTATTCCTGCAACTAACACAACCAT
TCCTGCAACTAACACAACTACTCCTGCAACTAACACAACCACTCCTGATGTTACCCCAGT
TATTCCTGCAACTAACACAACCACTCCTGCTACTAACACAACCACTCCTGCTACTAACAC
AACTACTCCTACTTAACCTTAATAGCCTAGTTGTGCAGTTATTTATTCAGAATGTGGTTA
CACTAATAAGATTTAAGAAGTTTGTTAGAATATCCCTAGTTTAGAAATTAGAAATATTAG
AAGTATTCAAGTACCTAATGGAACAACTCTTAAATTCTTCCAAAAAGAAAACTATAAAGG
TGTTAATGTTAAATTTTTGTAAAGCGTAGAATGCATTGAATTAGGTTTGAAAGAAGACCC
TAAAATTTAATGGGATGATTTAGTAAAATTATTTAATGCTGGAAAAATCGGATTTATTGA
TTCAGAAGGTAATGATATTGGGCTTCACAAAGCTAAAAAAGTATTCTTTAAGACAAATCT
AAGAATGTAACTTAGAAAGAAACACTCAAGTGATTGA