Identifiers and Description

Gene Model Identifier

TTHERM_00516390

Standard Name

CCF7 (C-terminal Crystallin Fold )

Aliases

PreTt10731 | 64.m00211 | 10731 | 3723.m00067

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and additional 200-residue motif weakly conserved among CCF6, CCF7, CCF8, and IGR1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00516390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16874.10.00000030014504373857585hypothetical protein (645 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00516390(coding)
ATGGTAACTTGTTAGTTAAATATATGCAAGAAAAAAGGAGATAAAAATTACGAATATAGT
TTCACATAAATTTATGAAGATAAAAATTAAATATCATAACATTTAAGAATTTTATAATAA
TTTCCACCTTTACTCAAAGATGACTGCATTACTTATCCATGCTTCATTCGTAGTGATAAT
TAAGATTTTATAGGTTTTTTCTAGAAGAATAAAAAACAATCTTTTTATCTTGAAGAATTA
ATTTAATCTAATGACTAAAAAGCCTAATAAAACATGAACTCAGAGTTAATTATTTTCTAA
TGGAGTGATCGCTTTACTCTCCATGAATTGAATTAAAATTAAGTTATAAAATAAAATCTT
GAGTTTCAATTCTATTTTTAAGATGAATATAATTAAATGGATAAGAATAGCATATTATTA
TACCATTACAATAAATTTAAGTTTGAAATGATAATAATTCGCAAAATTTCAATTAATTAC
ATGGAATACTATTACAGTTTAAATGTAATTATGCCCACAAAATAAAAAGATTCAAATATA
AACGATATTGAGTCTCTCAAAACTTAAATTTTGTGCTTTTCTAAATTTGAAACAGACTCC
GAAAATAATATTTATATACCTATAGTTTATTTAGAAAGCGAAAACAAATTATTTGGAGTG
TATAATTTCAGCATTAAATAAATGATAAAAGAATCAGTTCGCTTATCTGATTACACTAAG
AACATAGTTTCTACTTTTGATAAAGAAACTAAACAATTTATCCTGATCTTTAATAATTAG
ATTTGCAATCAAAATTACATTGCCTTTTATTCGTTTGATTTGGTTAAACTTAAATATAAG
TTTATAAATATGCATAAAGTTAACTATACTTTATAAAATAGTATATTGTAAAGTAAAAGA
CATACATTAGTACTTCTAAATAATGGTAGCTAGATAGTTAAGTTTGATAGAAATAAGAAA
TTTGAAGTGAAAAAAGTAATTAATCTCCAATATCTACAACCATTCTAAGATGCTAGACTT
AAAGAATACTTTATTTACATAAATGGTAAATTATCTAATAATATTTTATACAAAGGAGAA
TATCACTATTACTAGTATATACACTCAGACTATGTTACGAAACAAGTAATCCTTTCAGTT
TTAAATCAAAAAAACTAAACTTTAGAATTTTTCAACCTTAAATATGACAAATAATCTAAA
GAATAGGCTGATAATTAAAATAGTTATTCATAGAACATTCCTAATGTTTGTTAGCTAGAT
AATGGAGAAATAATAATTTTTATTGAACATAGAATTTTTATGCTAAAGAATAGCTATGAA
TGA


>TTHERM_00516390(protein)
MVTCQLNICKKKGDKNYEYSFTQIYEDKNQISQHLRILQQFPPLLKDDCITYPCFIRSDN
QDFIGFFQKNKKQSFYLEELIQSNDQKAQQNMNSELIIFQWSDRFTLHELNQNQVIKQNL
EFQFYFQDEYNQMDKNSILLYHYNKFKFEMIIIRKISINYMEYYYSLNVIMPTKQKDSNI
NDIESLKTQILCFSKFETDSENNIYIPIVYLESENKLFGVYNFSIKQMIKESVRLSDYTK
NIVSTFDKETKQFILIFNNQICNQNYIAFYSFDLVKLKYKFINMHKVNYTLQNSILQSKR
HTLVLLNNGSQIVKFDRNKKFEVKKVINLQYLQPFQDARLKEYFIYINGKLSNNILYKGE
YHYYQYIHSDYVTKQVILSVLNQKNQTLEFFNLKYDKQSKEQADNQNSYSQNIPNVCQLD
NGEIIIFIEHRIFMLKNSYE


>TTHERM_00516390(gene)
ATGGTAACTTGTTAGTTAAATATATGCAAGAAAAAAGGAGATAAAAATTACGAATATAGT
TTCACATAAATTTATGAAGATAAAAATTAAATATCATAACATTTAAGAATTTTATAATAA
TTTCCACCTTTACTCAAAGATGACTGCATTACTTATCCATGCTTCATTCGTAGTGATAAT
TAAGATTTTATAGGTTTTTTCTAGAAGAATAAAAAACAATCTTTTTATCTTGAAGAATTA
ATTTAATCTAATGACTAAAAAGCCTAATAAAACATGAACTCAGAGTTAATTATTTTCTAA
TGGAGTGATCGCTTTACTCTCCATGAATTGAATTAAAATTAAGTTATAAAATAAAATCTT
GAGTTTCAATTCTATTTTTAAGATGAATATAATTAAATGGATAAGAATAGCATATTATTA
TACCATTACAATAAATTTAAGTTTGAAATGATAATAATTCGCAAAATTTCAATTAATTAC
ATGGAATACTATTACAGTTTAAATGTAATTATGCCCACAAAATAAAAAGATTCAAATATA
AACGATATTGAGTCTCTCAAAACTTAAATTTTGTGCTTTTCTAAATTTGAAACAGACTCC
GAAAATAATATTTATATACCTATAGTTTATTTAGAAAGCGAAAACAAATTATTTGGAGTG
TATAATTTCAGCATTAAATAAATGATAAAAGAATCAGTTCGCTTATCTGATTACACTAAG
AACATAGTTTCTACTTTTGATAAAGAAACTAAACAATTTATCCTGATCTTTAATAATTAG
ATTTGCAATCAAAATTACATTGCCTTTTATTCGTTTGATTTGGTTAAACTTAAATATAAG
TTTATAAATATGCATAAAGTTAACTATACTTTATAAAATAGTATATTGTAAAGTAAAAGA
CATACATTAGTACTTCTAAATAATGGTAGCTAGATAGTTAAGTTTGATAGAAATAAGAAA
TTTGAAGTGAAAAAAGTAATTAATCTCCAATATCTACAACCATTCTAAGATGCTAGACTT
AAAGAATACTTTATTTACATAAATGGTAAATTATCTAATAATATTTTATACAAAGGAGAA
TATCACTATTACTAGTATATACACTCAGACTATGTTACGAAACAAGTAATCCTTTCAGTT
TTAAATCAAAAAAACTAAACTTTAGAATTTTTCAACCTTAAATATGACAAATAATCTAAA
GAATAGGCTGATAATTAAAATAGTTATTCATAGAACATTCCTAATGTTTGTTAGCTAGAT
AATGGAGAAATAATAATTTTTATTGAACATAGAATTTTTATGCTAAAGAATAGCTATGAA
TGA