Identifiers and Description

Gene Model Identifier

TTHERM_00516380

Standard Name

CCF6 (C-terminal Crystallin Fold 6)

Aliases

PreTt10730 | 64.m00210 | 3723.m00066

Description

CCF6 carboxy-terminal crystallin fold protein 7p putative; C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and additional 200-residue motif weakly conserved among CCF6- CCF7- CCF8- and IGR1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.2%

TetraMine Data

TTHERM_00516380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15450.14.001282277195165e-160hypothetical protein (310 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00516380(coding)
ATGCTTCTGTTTTATACTATTATTAAAGCAGTAATTAAGCATATGAAAGTTTTTGATTTT
TTGATATTTAATTTGATGAGATTAGTGCTAAAATCAGATAATAAATTAAAAATATAATCT
TATATTGATATAGATAAAGATAAATTGTTTAGCAAAAAAATAATGAGAAAGGCTAATTTA
ATATTTGTTATCTTAGGATTGACCCTAAGCGCCTGCTACGCTTAAACAGTAGTTGTCACT
GATTTTACTATAGCTGCTGGTAACTCAGTACCCTATATTAAAACATTCGAAAACTAATGG
AACGATGAATTAGAATTCGCTGTTTATGGATGGATCAGAATACCAAGTTGGGTTAATAGT
GAAGTTTAAGTATTCCGTTTATCTGCTAACAAAGACATAAATTCTAATACTCTTGGTGAT
AGAGTTTTGAAGTCTTTTGTCCAAGATAACAAAGTTATGTTCGAGACTTATGATGCTTAG
AATTACGACCCTAAAGTTTAACATTCTTATTTGAACCAAGGTGATAGTTTTGGATAATGG
TTCTTCATTTACTAGGGCTACAATCCTAAAACAACAAAGACTTATGGTTGGGTTTAAAAC
GCAGCTGGAAAAGGTTAAGGAGGTTACAGCAATTAATTAGCTAGACATACCAAGTCTAAT
TTCTATTAAGTAATCGTAGGTCCTAATTCAGGCCTTAAAGGAAGTGATAAAGTAGAAGTC
AAAATTCTTTGGATTTAAGCTGGATCTGGTGCTTACAGAGAAAACAACTTTGATACAAGA
GATACCAATGTAGTAGTAGTACCTATCCCATCTGTTAAATGCCCTACAGTTTACTCTCAA
TGTGATTACAAGGGAGATTCATCATCTTACTGTTAAAGTGTCCCTTCTGTCAAAATCCCT
GTAATTAAGAGTGTTGTAATCCCTGATGGATTCAATAAGATTACTGTGTATAATCTTGAA
AATTACAAAGGTAAGACCGTTATTTTTAACAAAAGCGTTTCTTGTCTCGACAAATTTGAA
TTTGCCTTCCTAGAGAGAGAAGGATATATCACAGTTATTGATAATAAAGAGTCAAAAAAA
TCTAAAAATGCTCTTAGATCAAACAGAAAATGA


>TTHERM_00516380(protein)
MLLFYTIIKAVIKHMKVFDFLIFNLMRLVLKSDNKLKIQSYIDIDKDKLFSKKIMRKANL
IFVILGLTLSACYAQTVVVTDFTIAAGNSVPYIKTFENQWNDELEFAVYGWIRIPSWVNS
EVQVFRLSANKDINSNTLGDRVLKSFVQDNKVMFETYDAQNYDPKVQHSYLNQGDSFGQW
FFIYQGYNPKTTKTYGWVQNAAGKGQGGYSNQLARHTKSNFYQVIVGPNSGLKGSDKVEV
KILWIQAGSGAYRENNFDTRDTNVVVVPIPSVKCPTVYSQCDYKGDSSSYCQSVPSVKIP
VIKSVVIPDGFNKITVYNLENYKGKTVIFNKSVSCLDKFEFAFLEREGYITVIDNKESKK
SKNALRSNRK


>TTHERM_00516380(gene)
ATGCTTCTGTTTTATACTATTATTAAAGCAGTAATTAAGCATATGAAAGTTTTTGATTTT
TTGATATTTAATTTGATGAGATTAGTGCTAAAATCAGATAATAAATTAAAAATATAATCT
TATATTGATATAGATAAAGATAAATTGTTTAGCAAAAAAATAATGAGAAAGGCTAATTTA
ATATTTGTTATCTTAGGATTGACCCTAAGCGCCTGCTACGCTTAAACAGTAGTTGTCACT
GATTTTACTATAGCTGCTGGTAACTCAGTACCCTATATTAAAACATTCGAAAACTAATGG
AACGATGAATTAGAATTCGCTGTTTATGGATGGATCAGAATACCAAGTTGGGTTAATAGT
GAAGTTTAAGTATTCCGTTTATCTGCTAACAAAGACATAAATTCTAATACTCTTGGTGAT
AGAGTTTTGAAGTCTTTTGTCCAAGATAACAAAGTTATGTTCGAGACTTATGATGCTTAG
AATTACGACCCTAAAGTTTAACATTCTTATTTGAACCAAGGTGATAGTTTTGGATAATGG
TTCTTCATTTACTAGGGCTACAATCCTAAAACAACAAAGACTTATGGTTGGGTTTAAAAC
GCAGCTGGAAAAGGTTAAGGAGGTTACAGCAATTAATTAGCTAGACATACCAAGTCTAAT
TTCTATTAAGTAATCGTAGGTCCTAATTCAGGCCTTAAAGGAAGTGATAAAGTAGAAGTC
AAAATTCTTTGGATTTAAGCTGGATCTGGTGCTTACAGAGAAAACAACTTTGATACAAGA
GATACCAATGTAGTAGTAGTACCTATCCCATCTGTTAAATGCCCTACAGTTTACTCTCAA
TGTGATTACAAGGGAGATTCATCATCTTACTGTTAAAGTGTCCCTTCTGTCAAAATCCCT
GTAATTAAGAGTGTTGTAATCCCTGATGGATTCAATAAGATTACTGTGTATAATCTTGAA
AATTACAAAGGTAAGACCGTTATTTTTAACAAAAGCGTTTCTTGTCTCGACAAATTTGAA
TTTGCCTTCCTAGAGAGAGAAGGATATATCACAGTTATTGATAATAAAGAGTCAAAAAAA
TCTAAAAATGCTCTTAGATCAAACAGAAAATGA