Identifiers and Description

Gene Model Identifier

TTHERM_00516380

Standard Name

CCF6 (C-terminal Crystallin Fold 6)

Aliases

PreTt10730 | 64.m00210 | 3723.m00066

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains signal peptide and additional 200-residue motif weakly conserved among CCF6, CCF7, CCF8, and IGR1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.2%

TetraMine Data

TTHERM_00516380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15450.14.001282277195165e-160hypothetical protein (310 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_00516380(coding)
ATGCTTCTGTTTTATACTATTATTAAAGCAGTAATTAAGCATATGAAAGTTTTTGATTTT
TTGATATTTAATTTGATGAGATTAGTGCTAAAATCAGATAATAAATTAAAAATATAATCT
TATATTGATATAGATAAAGATAAATTGTTTAGCAAAAAAATAATGAGAAAGGCTAATTTA
ATATTTGTTATCTTAGGATTGACCCTAAGCGCCTGCTACGCTTAAACAGTAGTTGTCACT
GATTTTACTATAGCTGCTGGTAACTCAGTACCCTATATTAAAACATTCGAAAACTAATGG
AACGATGAATTAGAATTCGCTGTTTATGGATGGATCAGAATACCAAGTTGGGTTAATAGT
GAAGTTTAAGTATTCCGTTTATCTGCTAACAAAGACATAAATTCTAATACTCTTGGTGAT
AGAGTTTTGAAGTCTTTTGTCCAAGATAACAAAGTTATGTTCGAGACTTATGATGCTTAG
AATTACGACCCTAAAGTTTAACATTCTTATTTGAACCAAGGTGATAGTTTTGGATAATGG
TTCTTCATTTACTAGGGCTACAATCCTAAAACAACAAAGACTTATGGTTGGGTTTAAAAC
GCAGCTGGAAAAGGTTAAGGAGGTTACAGCAATTAATTAGCTAGACATACCAAGTCTAAT
TTCTATTAAGTAATCGTAGGTCCTAATTCAGGCCTTAAAGGAAGTGATAAAGTAGAAGTC
AAAATTCTTTGGATTTAAGCTGGATCTGGTGCTTACAGAGAAAACAACTTTGATACAAGA
GATACCAATGTAGTAGTAGTACCTATCCCATCTGTTAAATGCCCTACAGTTTACTCTCAA
TGTGATTACAAGGGAGATTCATCATCTTACTGTTAAAGTGTCCCTTCTGTCAAAATCCCT
GTAATTAAGAGTGTTGTAATCCCTGATGGATTCAATAAGATTACTGTGTATAATCTTGAA
AATTACAAAGGTAAGACCGTTATTTTTAACAAAAGCGTTTCTTGTCTCGACAAATTTGAA
TTTGCCTTCCTAGAGAGAGAAGGATATATCACAGTTATTGATAATAAAGAGTCAAAAAAA
TCTAAAAATGCTCTTAGATCAAACAGAAAATGA


>TTHERM_00516380(protein)
MLLFYTIIKAVIKHMKVFDFLIFNLMRLVLKSDNKLKIQSYIDIDKDKLFSKKIMRKANL
IFVILGLTLSACYAQTVVVTDFTIAAGNSVPYIKTFENQWNDELEFAVYGWIRIPSWVNS
EVQVFRLSANKDINSNTLGDRVLKSFVQDNKVMFETYDAQNYDPKVQHSYLNQGDSFGQW
FFIYQGYNPKTTKTYGWVQNAAGKGQGGYSNQLARHTKSNFYQVIVGPNSGLKGSDKVEV
KILWIQAGSGAYRENNFDTRDTNVVVVPIPSVKCPTVYSQCDYKGDSSSYCQSVPSVKIP
VIKSVVIPDGFNKITVYNLENYKGKTVIFNKSVSCLDKFEFAFLEREGYITVIDNKESKK
SKNALRSNRK


>TTHERM_00516380(gene)
CAAAAATGCTTCTGTTTTATACTATTATTAAAGCAGTAATTAAGCATATGAAAGTTTTTG
ATTTTTTGATATTTAATTTGATGAGATTAGTGCTAAAATCAGATAATAAATTAAAAATAT
AATCTTATATTGATATAGATAAAGATAAATTGTTTAGCAAAAAAATAATGAGAAAGGCTA
ATTTAATATTTGTTATCTTAGGATTGACCCTAAGCGCCTGCTACGCTTAAACAGTAGTTG
TCACTGATTTTACTATAGCTGCTGGTAACTCAGTACCCTATATTAAAACATTCGAAAACT
AATGGAACGATGAATTAGAATTCGCTGTTTATGGATGGATCAGAATACCAAGTTGGGTTA
ATAGTGAAGTTTAAGTATTCCGTTTATCTGCTAACAAAGACATAAATTCTAATACTCTTG
GTGATAGAGTTTTGAAGTCTTTTGTCCAAGATAACAAAGTTATGTTCGAGACTTATGATG
CTTAGAATTACGACCCTAAAGTTTAACATTCTTATTTGAACCAAGGTGATAGTTTTGGAT
AATGGTTCTTCATTTACTAGGGCTACAATCCTAAAACAACAAAGACTTATGGTTGGGTTT
AAAACGCAGCTGGAAAAGGTTAAGGAGGTTACAGCAATTAATTAGCTAGACATACCAAGT
CTAATTTCTATTAAGTAATCGTAGGTCCTAATTCAGGCCTTAAAGGAAGTGATAAAGTAG
AAGTCAAAATTCTTTGGATTTAAGCTGGATCTGGTGCTTACAGAGAAAACAACTTTGATA
CAAGAGATACCAATGTAGTAGTAGTACCTATCCCATCTGTTAAATGCCCTACAGTTTACT
CTCAATGTGATTACAAGGGAGATTCATCATCTTACTGTTAAAGTGTCCCTTCTGTCAAAA
TCCCTGTAATTAAGAGTGTTGTAATCCCTGATGGATTCAATAAGATTACTGTGTATAATC
TTGAAAATTACAAAGGTAAGACCGTTATTTTTAACAAAAGCGTTTCTTGTCTCGACAAAT
TTGAATTTGCCTTCCTAGAGAGAGAAGGATATATCACAGTTATTGATAATAAAGAGTCAA
AAAAATCTAAAAATGCTCTTAGATCAAACAGAAAATGAAGACTTTTATTGCATATACTAA
AAATAGATCTTTTATAAATATGAAATCTAAAAAATTTAAAATATAGATTTTTATCAAAAC
TATTTGTTGAGTTATGATTTTTCATTTTTTTAATTCTTGTTTATTAAAATTCAAAACATT
TTAAATGCATTTTTGCATATTATTTATTTTAAGACAAAAAAAAACTATCAATTAATTGAA
GAGAAAAAGTAATTAACTAATCAAAGAATATGGCGAACGTCATAAATAATCTAAATTCTT
AAAAAATACATGTG