Identifiers and Description

Gene Model Identifier

TTHERM_01002870

Standard Name

CCF4 (C-terminal Crystallin Fold 4 )

Aliases

PreTt17207 | 191.m00067 | 3761.m00259

Description

CCF4 carboxy-terminal crystallin fold protein; C-terminal crystallin fold protein; domain structure suggests localization in dense core granules; contains additional tandem copies of a 150-residue motif shared by CCF3- CCF4- GRT1- and GRT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 84%

TetraMine Data

TTHERM_01002870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19854.19.997093137033517e-262hypothetical protein (437 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_01002870(coding)
ATGCAAAAGGGATATATTTTAATTGCCTTAATTTTGCTCGGTTTCGCATCAGCTAACTTT
TACGAAATCGATAAGGAGTTTACTAGCTCAACATTTGATGGTAGAGCTCTTAATAGCTGG
AAACTTGCTGGTTTCTAAAATTCTATCACAAATAATTGTGGTGGTGTTTCAGTAGTTGGT
GGTCCCAATGTTGTTGCAACTGGTTCAATGTCCAAGAATTTTACTACTGATTTTGATCTT
ACCTCCATTAATATTTCATTTGATTTATATTTGTTCGATTAATGGCTTTCTGGTTGGGAA
GGCGGTAGAGATTAAAATACTTTATTCAAGGTATTCGTTAACAACTAATAGGTACATTAA
CTTGGATCAGATTACACAAGATAAATTCACTAAAAATCTAGCAATATTTGTGGCCAACCC
GACCCTGATAGATTGACTCACGTTTCAGTTTCAGTTCCTGTCACTGGTAGATCATTTAAT
GTTACTCTCCAAGCCAATATTGCATCAAACAACCCAAGTGTTGCTTCTTGGGGTATCAGA
AATTTCTACATTTTATCATCTTATGGAGCTGATAATTCCAAGGTTGTTGCTTCTGAACTT
TCTAATGATAATGCTTTTGATGTCACCAGTTGGACTTCTACATTCCAAAACGCTGTTACT
TCTTGCCCCAATAAGATTGTTGGTGGTTTCAATGTCGCTGGTCCTGGTTCATATGCTGTT
AGAAAGCTATCTAATCTTCCTCCTCACTCTTTCTTGACTATTAGCATCAATGCCTTCTTC
GTTGATTCTATTGATTCTAACGACTCTATCATCTTCTACGTTGATGGTAAAATAGTACAT
GAAGAAACTAGATAATTCTTCTTGGCAAGCAAAAATATTTGTGGTGCTGGTTGGAATGAT
AATGTTAATAACAAATTCGTATTTTTGATTCCTCACTTTGCACCCACTGCTGAATTCAAG
ATCTATATCAATACTGACCAAGCTGCTGGAGATGAATCTTTCGGTTTCAGAGATTTATAA
GTATCAGCTGACAGTCCTTGCCCTATTATTTACGAAGGAGCTAACTAATAAGGTAGAGCC
TTCTCCTTCTGTGGTGATATTCCTGATCTTAAAAAGATTGGCTGGACTAAACCCATTAAA
GGTATTTATGTTCCCGAAGGTTATGCAATTAAGGTTTACGTAGACTCTAATTTCCAAGGA
AAGAGATTCAAGGTCTCCAAATCTAACTTCAACCTCACCGGAAAGGAATACAAGTTAGTT
AACAGAGCTTTCAATATTGATGTAAATGAATAAAAGCTCAGACGTAATGAATGA


>TTHERM_01002870(protein)
MQKGYILIALILLGFASANFYEIDKEFTSSTFDGRALNSWKLAGFQNSITNNCGGVSVVG
GPNVVATGSMSKNFTTDFDLTSINISFDLYLFDQWLSGWEGGRDQNTLFKVFVNNQQVHQ
LGSDYTRQIHQKSSNICGQPDPDRLTHVSVSVPVTGRSFNVTLQANIASNNPSVASWGIR
NFYILSSYGADNSKVVASELSNDNAFDVTSWTSTFQNAVTSCPNKIVGGFNVAGPGSYAV
RKLSNLPPHSFLTISINAFFVDSIDSNDSIIFYVDGKIVHEETRQFFLASKNICGAGWND
NVNNKFVFLIPHFAPTAEFKIYINTDQAAGDESFGFRDLQVSADSPCPIIYEGANQQGRA
FSFCGDIPDLKKIGWTKPIKGIYVPEGYAIKVYVDSNFQGKRFKVSKSNFNLTGKEYKLV
NRAFNIDVNEQKLRRNE


>TTHERM_01002870(gene)
ATGCAAAAGGGATATATTTTAATTGCCTTAATTTTGCTCGGTTTCGCATCAGCTAACTTT
TACGAAATCGATAAGGAGTTTACTAGCTCAACATTTGATGGTAGAGCTCTTAATAGCTGG
AAACTTGCTGGTTTCTAAAATTCTATCACAAATAATTGTGGTGGTGTTTCAGTAGTTGGT
GGTCCCAATGTTGTTGCAACTGGTTCAATGTCCAAGAATTTTACTACTGATTTTGATCTT
ACCTCCATTAATATTTCATTTGATTTATATTTGTTCGATTAATGGCTTTCTGGTTGGGAA
GGCGGTAGAGATTAAAATACTTTATTCAAGGTATTCGTTAACAACTAATAGGTACATTAA
CTTGGATCAGATTACACAAGATAAATTCACTAAAAATCTAGCAATATTTGTGGCCAACCC
GACCCTGATAGATTGACTCACGTTTCAGTTTCAGTTCCTGTCACTGGTAGATCATTTAAT
GTTACTCTCCAAGCCAATATTGCATCAAACAACCCAAGTGTTGCTTCTTGGGGTATCAGA
AATTTCTACATTTTATCATCTTATGGAGCTGATAATTCCAAGGTTGTTGCTTCTGAACTT
TCTAATGATAATGCTTTTGATGTCACCAGTTGGACTTCTACATTCCAAAACGCTGTTACT
TCTTGCCCCAATAAGATTGTTGGTGGTTTCAATGTCGCTGGTCCTGGTTCATATGCTGTT
AGAAAGCTATCTAATCTTCCTCCTCACTCTTTCTTGACTATTAGCATCAATGCCTTCTTC
GTTGATTCTATTGATTCTAACGACTCTATCATCTTCTACGTTGATGGTAAAATAGTACAT
GAAGAAACTAGATAATTCTTCTTGGCAAGCAAAAATATTTGTGGTGCTGGTTGGAATGAT
AATGTTAATAACAAATTCGTATTTTTGATTCCTCACTTTGCACCCACTGCTGAATTCAAG
ATCTATATCAATACTGACCAAGCTGCTGGAGATGAATCTTTCGGTTTCAGAGATTTATAA
GTATCAGCTGACAGTCCTTGCCCTATTATTTACGAAGGAGCTAACTAATAAGGTAGAGCC
TTCTCCTTCTGTGGTGATATTCCTGATCTTAAAAAGATTGGCTGGACTAAACCCATTAAA
GGTATTTATGTTCCCGAAGGTTATGCAATTAAGGTTTACGTAGACTCTAATTTCCAAGGA
AAGAGATTCAAGGTCTCCAAATCTAACTTCAACCTCACCGGAAAGGAATACAAGTTAGTT
AACAGAGCTTTCAATATTGATGTAAATGAATAAAAGCTCAGACGTAATGAATGA