Identifiers and Description

Gene Model Identifier

TTHERM_01002860

Standard Name

CCF3 (C-terminal Crystallin Fold 3)

Aliases

PreTt17206 | 191.m00066 | 3761.m00258

Description

CCF3 carboxy-terminal crystallin fold protein; C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains additional tandem copies of a 150-residue motif shared by CCF3- CCF4- GRT1- and GRT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 83.8%

TetraMine Data

TTHERM_01002860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19854.19.997093137033517e-262hypothetical protein (437 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_01002860(coding)
ATGTAAAAAGGATACATCTTAGTAGCCTTACTTTTAGTAGGTTTTGCTTCCGCTAACTTC
TACGAAGTTGCCAAGGAATTCACTCTCAATAACTTCAATTCCAAATCTCTTAGCAGTTGG
AATCTTGTTAACTTCAAGGGAGATTAAGTCGCCAATTGCAATGGTGTTTCTGTTGTTGGT
GGTCCCAGCGTCGTTGCCAGTGGTTCAATGACCAAAACTTTCACAACTGATTTTGATCTC
AACGGAGTTAATATCTCTTTCGACTTATATTTCTTTGATAAATGGTTCTCTGGTTGGGAT
GGTGGTAGAGATTAGAACACCTTGTTCAAGATCTTCGTTAATAACCAATAAGTTTACCAA
CTTGGTTCTGATTACACCAGATCCCTCCATGCTGATTAACCCAATCTTTGTGGTGATGCT
ACTCCTGATAGATAAACTCACATTTCTCTTGATGTCCCCGCTACTGGTAGAAACATCACT
GTCTAACTTGTTGCCAACATCGCTTCCAATAATCCTGCAGTTGCCTCTTGGGGTATCAGA
AATTTCTACATTTTATCATAATAAGGTTATGATGATTCTTAAGTTGTTGTTAGTGAACTC
AATGATGATTCCAATTTCGATGTTTCTCAATGGTAAACAAATTTCAAAGGTGTAATCACA
TAATGCCCTTCAAAGCTCCTTGGTGGTTACAATGCTGCTGGACCTAAAGCCACTGCTGTT
AGAAAACTCGCAAGTCTCCCTGCTCACTCCTTCTTGACTGTTTCCCTCAGTGCTTATTTC
ATTGATTCCATTGATGCTAATGATTCAGTTGTTATTTACGTTGATGGAAAGGTTGCCCAT
GAACACTAAAAGGCTTATTATGAAGATAGTACTAATGTTTGCGGTGCTGCCTGGAACGAC
GGTGTTGATAATGAATTAAATATCATTGTTCCTCACTTTGCTTCTACTGCTGAAATCAAA
ATTTACGTCAATACTGACCAAGCTCCTGGTGATGAATCCTTCGGTTTCAGAGAATTCTAA
GTTTCTGTTTCTTCTCCCTGTCCTATTCTCTACACTGATGTTAATCAAGGAGGTAGACAA
TTCTCCTTCTGTGGTAATCTTCCTGATCTCAAGGCTGTTGGTTGGACCGCTCCTATTAAA
GGTATTTACCTTCCCAAGGGAGTTGAACTCACTGTCTACTAAGATTCTAACTACAATGGA
AAGAAATACACTGTTAAGAAATCTAACTTCAATCTCTCAGGTAATGAATACTAATTGATT
AACAAAGCTTTAAACATTGATGTTACTGAATAAAAGCTTAGACGTAACAAGTGA


>TTHERM_01002860(protein)
MQKGYILVALLLVGFASANFYEVAKEFTLNNFNSKSLSSWNLVNFKGDQVANCNGVSVVG
GPSVVASGSMTKTFTTDFDLNGVNISFDLYFFDKWFSGWDGGRDQNTLFKIFVNNQQVYQ
LGSDYTRSLHADQPNLCGDATPDRQTHISLDVPATGRNITVQLVANIASNNPAVASWGIR
NFYILSQQGYDDSQVVVSELNDDSNFDVSQWQTNFKGVITQCPSKLLGGYNAAGPKATAV
RKLASLPAHSFLTVSLSAYFIDSIDANDSVVIYVDGKVAHEHQKAYYEDSTNVCGAAWND
GVDNELNIIVPHFASTAEIKIYVNTDQAPGDESFGFREFQVSVSSPCPILYTDVNQGGRQ
FSFCGNLPDLKAVGWTAPIKGIYLPKGVELTVYQDSNYNGKKYTVKKSNFNLSGNEYQLI
NKALNIDVTEQKLRRNK


>TTHERM_01002860(gene)
ATGTAAAAAGGATACATCTTAGTAGCCTTACTTTTAGTAGGTTTTGCTTCCGCTAACTTC
TACGAAGTTGCCAAGGAATTCACTCTCAATAACTTCAATTCCAAATCTCTTAGCAGTTGG
AATCTTGTTAACTTCAAGGGAGATTAAGTCGCCAATTGCAATGGTGTTTCTGTTGTTGGT
GGTCCCAGCGTCGTTGCCAGTGGTTCAATGACCAAAACTTTCACAACTGATTTTGATCTC
AACGGAGTTAATATCTCTTTCGACTTATATTTCTTTGATAAATGGTTCTCTGGTTGGGAT
GGTGGTAGAGATTAGAACACCTTGTTCAAGATCTTCGTTAATAACCAATAAGTTTACCAA
CTTGGTTCTGATTACACCAGATCCCTCCATGCTGATTAACCCAATCTTTGTGGTGATGCT
ACTCCTGATAGATAAACTCACATTTCTCTTGATGTCCCCGCTACTGGTAGAAACATCACT
GTCTAACTTGTTGCCAACATCGCTTCCAATAATCCTGCAGTTGCCTCTTGGGGTATCAGA
AATTTCTACATTTTATCATAATAAGGTTATGATGATTCTTAAGTTGTTGTTAGTGAACTC
AATGATGATTCCAATTTCGATGTTTCTCAATGGTAAACAAATTTCAAAGGTGTAATCACA
TAATGCCCTTCAAAGCTCCTTGGTGGTTACAATGCTGCTGGACCTAAAGCCACTGCTGTT
AGAAAACTCGCAAGTCTCCCTGCTCACTCCTTCTTGACTGTTTCCCTCAGTGCTTATTTC
ATTGATTCCATTGATGCTAATGATTCAGTTGTTATTTACGTTGATGGAAAGGTTGCCCAT
GAACACTAAAAGGCTTATTATGAAGATAGTACTAATGTTTGCGGTGCTGCCTGGAACGAC
GGTGTTGATAATGAATTAAATATCATTGTTCCTCACTTTGCTTCTACTGCTGAAATCAAA
ATTTACGTCAATACTGACCAAGCTCCTGGTGATGAATCCTTCGGTTTCAGAGAATTCTAA
GTTTCTGTTTCTTCTCCCTGTCCTATTCTCTACACTGATGTTAATCAAGGAGGTAGACAA
TTCTCCTTCTGTGGTAATCTTCCTGATCTCAAGGCTGTTGGTTGGACCGCTCCTATTAAA
GGTATTTACCTTCCCAAGGGAGTTGAACTCACTGTCTACTAAGATTCTAACTACAATGGA
AAGAAATACACTGTTAAGAAATCTAACTTCAATCTCTCAGGTAATGAATACTAATTGATT
AACAAAGCTTTAAACATTGATGTTACTGAATAAAAGCTTAGACGTAACAAGTGA