Identifiers and Description

Gene Model Identifier

TTHERM_01002860

Standard Name

CCF3 (C-terminal Crystallin Fold 3)

Aliases

PreTt17206 | 191.m00066 | 3761.m00258

Description

C-terminal crystallin fold protein; domain structure and protein isolation suggest localization in dense core granules; contains additional tandem copies of a 150-residue motif shared by CCF3, CCF4, GRT1, and GRT2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 83.8%

TetraMine Data

TTHERM_01002860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19854.19.997093137033517e-262hypothetical protein (437 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7

Sequences

>TTHERM_01002860(coding)
ATGTAAAAAGGATACATCTTAGTAGCCTTACTTTTAGTAGGTTTTGCTTCCGCTAACTTC
TACGAAGTTGCCAAGGAATTCACTCTCAATAACTTCAATTCCAAATCTCTTAGCAGTTGG
AATCTTGTTAACTTCAAGGGAGATTAAGTCGCCAATTGCAATGGTGTTTCTGTTGTTGGT
GGTCCCAGCGTCGTTGCCAGTGGTTCAATGACCAAAACTTTCACAACTGATTTTGATCTC
AACGGAGTTAATATCTCTTTCGACTTATATTTCTTTGATAAATGGTTCTCTGGTTGGGAT
GGTGGTAGAGATTAGAACACCTTGTTCAAGATCTTCGTTAATAACCAATAAGTTTACCAA
CTTGGTTCTGATTACACCAGATCCCTCCATGCTGATTAACCCAATCTTTGTGGTGATGCT
ACTCCTGATAGATAAACTCACATTTCTCTTGATGTCCCCGCTACTGGTAGAAACATCACT
GTCTAACTTGTTGCCAACATCGCTTCCAATAATCCTGCAGTTGCCTCTTGGGGTATCAGA
AATTTCTACATTTTATCATAATAAGGTTATGATGATTCTTAAGTTGTTGTTAGTGAACTC
AATGATGATTCCAATTTCGATGTTTCTCAATGGTAAACAAATTTCAAAGGTGTAATCACA
TAATGCCCTTCAAAGCTCCTTGGTGGTTACAATGCTGCTGGACCTAAAGCCACTGCTGTT
AGAAAACTCGCAAGTCTCCCTGCTCACTCCTTCTTGACTGTTTCCCTCAGTGCTTATTTC
ATTGATTCCATTGATGCTAATGATTCAGTTGTTATTTACGTTGATGGAAAGGTTGCCCAT
GAACACTAAAAGGCTTATTATGAAGATAGTACTAATGTTTGCGGTGCTGCCTGGAACGAC
GGTGTTGATAATGAATTAAATATCATTGTTCCTCACTTTGCTTCTACTGCTGAAATCAAA
ATTTACGTCAATACTGACCAAGCTCCTGGTGATGAATCCTTCGGTTTCAGAGAATTCTAA
GTTTCTGTTTCTTCTCCCTGTCCTATTCTCTACACTGATGTTAATCAAGGAGGTAGACAA
TTCTCCTTCTGTGGTAATCTTCCTGATCTCAAGGCTGTTGGTTGGACCGCTCCTATTAAA
GGTATTTACCTTCCCAAGGGAGTTGAACTCACTGTCTACTAAGATTCTAACTACAATGGA
AAGAAATACACTGTTAAGAAATCTAACTTCAATCTCTCAGGTAATGAATACTAATTGATT
AACAAAGCTTTAAACATTGATGTTACTGAATAAAAGCTTAGACGTAACAAGTGA


>TTHERM_01002860(protein)
MQKGYILVALLLVGFASANFYEVAKEFTLNNFNSKSLSSWNLVNFKGDQVANCNGVSVVG
GPSVVASGSMTKTFTTDFDLNGVNISFDLYFFDKWFSGWDGGRDQNTLFKIFVNNQQVYQ
LGSDYTRSLHADQPNLCGDATPDRQTHISLDVPATGRNITVQLVANIASNNPAVASWGIR
NFYILSQQGYDDSQVVVSELNDDSNFDVSQWQTNFKGVITQCPSKLLGGYNAAGPKATAV
RKLASLPAHSFLTVSLSAYFIDSIDANDSVVIYVDGKVAHEHQKAYYEDSTNVCGAAWND
GVDNELNIIVPHFASTAEIKIYVNTDQAPGDESFGFREFQVSVSSPCPILYTDVNQGGRQ
FSFCGNLPDLKAVGWTAPIKGIYLPKGVELTVYQDSNYNGKKYTVKKSNFNLSGNEYQLI
NKALNIDVTEQKLRRNK


>TTHERM_01002860(gene)
TAATTATCAATACAAATACATTAAAAAGAAACATTATTAAAAATGTAAAAAGGATACATC
TTAGTAGCCTTACTTTTAGTAGGTTTTGCTTCCGCTAACTTCTACGAAGTTGCCAAGGAA
TTCACTCTCAATAACTTCAATTCCAAATCTCTTAGCAGTTGGAATCTTGTTAACTTCAAG
GGAGATTAAGTCGCCAATTGCAATGGTGTTTCTGTTGTTGGTGGTCCCAGCGTCGTTGCC
AGTGGTTCAATGACCAAAACTTTCACAACTGATTTTGATCTCAACGGAGTTAATATCTCT
TTCGACTTATATTTCTTTGATAAATGGTTCTCTGGTTGGGATGGTGGTAGAGATTAGAAC
ACCTTGTTCAAGATCTTCGTTAATAACCAATAAGTTTACCAACTTGGTTCTGATTACACC
AGATCCCTCCATGCTGATTAACCCAATCTTTGTGGTGATGCTACTCCTGATAGATAAACT
CACATTTCTCTTGATGTCCCCGCTACTGGTAGAAACATCACTGTCTAACTTGTTGCCAAC
ATCGCTTCCAATAATCCTGCAGTTGCCTCTTGGGGTATCAGAAATTTCTACATTTTATCA
TAATAAGGTTATGATGATTCTTAAGTTGTTGTTAGTGAACTCAATGATGATTCCAATTTC
GATGTTTCTCAATGGTAAACAAATTTCAAAGGTGTAATCACATAATGCCCTTCAAAGCTC
CTTGGTGGTTACAATGCTGCTGGACCTAAAGCCACTGCTGTTAGAAAACTCGCAAGTCTC
CCTGCTCACTCCTTCTTGACTGTTTCCCTCAGTGCTTATTTCATTGATTCCATTGATGCT
AATGATTCAGTTGTTATTTACGTTGATGGAAAGGTTGCCCATGAACACTAAAAGGCTTAT
TATGAAGATAGTACTAATGTTTGCGGTGCTGCCTGGAACGACGGTGTTGATAATGAATTA
AATATCATTGTTCCTCACTTTGCTTCTACTGCTGAAATCAAAATTTACGTCAATACTGAC
CAAGCTCCTGGTGATGAATCCTTCGGTTTCAGAGAATTCTAAGTTTCTGTTTCTTCTCCC
TGTCCTATTCTCTACACTGATGTTAATCAAGGAGGTAGACAATTCTCCTTCTGTGGTAAT
CTTCCTGATCTCAAGGCTGTTGGTTGGACCGCTCCTATTAAAGGTATTTACCTTCCCAAG
GGAGTTGAACTCACTGTCTACTAAGATTCTAACTACAATGGAAAGAAATACACTGTTAAG
AAATCTAACTTCAATCTCTCAGGTAATGAATACTAATTGATTAACAAAGCTTTAAACATT
GATGTTACTGAATAAAAGCTTAGACGTAACAAGTGA