Identifiers and Description

Gene Model Identifier

TTHERM_00570550

Standard Name

CCF13 (C-terminal Crystallin Fold )

Aliases

PreTt10484 | 76.m00186 | 10484 | 3810.m02046

Description

C-terminal crystallin fold protein; domain structure suggests localization in dense core granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 83.2%

TetraMine Data

TTHERM_00570550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03454.12.000130478826482e-26hypothetical protein (185 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00570550(coding)
ATGAAAACTACTTTGGTGGTATTTATTATTTTAGGATTAGCCTTTTCTAAGATAGGCGCA
AAATAAAGTTAAACATAGAGTGTTACAATCAACAATAATAATCCAATGTAGAGTGTTACG
ATCACCAAAGGAGGGTAGCCATAAGGTGATACTACTACATGGGATGGAGTTTATAAAAGT
TTGAAAGTGACTGATATTGGTTAAAAACCTGTAGATCCTGTTGTTACTCCTGCTCAATGG
GATGGAGTTTATAAGAGTTTGAAAGTGACTAATGATGTTACAAAACCTGAAGAACCTCCT
GTTTTACCACCAAAAGTATGCCCCACTCTTTACAAGCAATGCTATTTCAAAGGAGATCCA
ATCTAGCTTTGTGATAAAATTCCTAAATTCGATATTAAAACCATTCATAGTGTCTGGATC
CCTGATGGCAGCAGAGTTACTCTTTATGAAAAAAGCGACTATAGCGGAAAATCAATAACC
TTCAAAGAGACTATTCCTTGCATTGATTCATTAAGTTTCTCTTGA


>TTHERM_00570550(protein)
MKTTLVVFIILGLAFSKIGAKQSQTQSVTINNNNPMQSVTITKGGQPQGDTTTWDGVYKS
LKVTDIGQKPVDPVVTPAQWDGVYKSLKVTNDVTKPEEPPVLPPKVCPTLYKQCYFKGDP
IQLCDKIPKFDIKTIHSVWIPDGSRVTLYEKSDYSGKSITFKETIPCIDSLSFS


>TTHERM_00570550(gene)
ATAAAGATATTAAAAACGAAAACAAAAATTACAAAACAAATACTTTGCGATATTATTTAA
TGAAAACTACTTTGGTGGTATTTATTATTTTAGGATTAGCCTTTTCTAAGATAGGCGCAA
AATAAAGTTAAACATAGAGTGTTACAATCAACAATAATAATCCAATGTAGAGTGTTACGA
TCACCAAAGGAGGGTAGCCATAAGGTGATACTACTACATGGGATGGAGTTTATAAAAGTT
TGAAAGTGACTGATATTGGTTAAAAACCTGTAGATCCTGTTGTTACTCCTGCTCAATGGG
ATGGAGTTTATAAGAGTTTGAAAGTGACTAATGATGTTACAAAACCTGAAGAACCTCCTG
TTTTACCACCAAAAGTATGCCCCACTCTTTACAAGCAATGCTATTTCAAAGGAGATCCAA
TCTAGCTTTGTGATAAAATTCCTAAATTCGATATTAAAACCATTCATAGTGTCTGGATCC
CTGATGGCAGCAGAGTTACTCTTTATGAAAAAAGCGACTATAGCGGAAAATCAATAACCT
TCAAAGAGACTATTCCTTGCATTGATTCATTAAGTTTCTCTTGAAAGAAGCTGGTCAAAT
ACTAAAAAAATATTTGCAAGCTTATAGAAAATAAATATTTTATATAATAGTATGAATACA
TTAATATCTAAGTGGATTTATATCTATTTAGTAGAAGATTAATTAAATATCACAAAATAA
ATAATTGAATTT